BLASTX nr result
ID: Coptis21_contig00016189
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis21_contig00016189 (275 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004168984.1| PREDICTED: pentatricopeptide repeat-containi... 65 4e-09 ref|XP_004146598.1| PREDICTED: pentatricopeptide repeat-containi... 65 4e-09 ref|XP_004168986.1| PREDICTED: pentatricopeptide repeat-containi... 62 6e-08 ref|XP_004146650.1| PREDICTED: pentatricopeptide repeat-containi... 62 6e-08 ref|XP_002531596.1| pentatricopeptide repeat-containing protein,... 60 1e-07 >ref|XP_004168984.1| PREDICTED: pentatricopeptide repeat-containing protein At2g20710, mitochondrial-like [Cucumis sativus] Length = 461 Score = 65.5 bits (158), Expect = 4e-09 Identities = 35/62 (56%), Positives = 44/62 (70%), Gaps = 2/62 (3%) Frame = +3 Query: 96 FYTT--DTNLFKRISSVGDQTVSVVPLLQQWVIEEERSVTEDKLNNFIKYLKARKRFKHA 269 FY+T NL++RIS VGD +SV PLL QWV+ E R V +D+L + IK L+ KRFKHA Sbjct: 22 FYSTVVKDNLYRRISPVGDPNISVTPLLDQWVL-EGRLVQQDELRHIIKELRVYKRFKHA 80 Query: 270 LE 275 LE Sbjct: 81 LE 82 >ref|XP_004146598.1| PREDICTED: pentatricopeptide repeat-containing protein At2g20710, mitochondrial-like [Cucumis sativus] Length = 227 Score = 65.5 bits (158), Expect = 4e-09 Identities = 35/62 (56%), Positives = 44/62 (70%), Gaps = 2/62 (3%) Frame = +3 Query: 96 FYTT--DTNLFKRISSVGDQTVSVVPLLQQWVIEEERSVTEDKLNNFIKYLKARKRFKHA 269 FY+T NL++RIS VGD +SV PLL QWV+ E R V +D+L + IK L+ KRFKHA Sbjct: 22 FYSTVVKDNLYRRISPVGDPNISVTPLLDQWVL-EGRLVQQDELRHIIKELRVYKRFKHA 80 Query: 270 LE 275 LE Sbjct: 81 LE 82 >ref|XP_004168986.1| PREDICTED: pentatricopeptide repeat-containing protein At2g20710, mitochondrial-like [Cucumis sativus] Length = 191 Score = 61.6 bits (148), Expect = 6e-08 Identities = 33/62 (53%), Positives = 43/62 (69%), Gaps = 2/62 (3%) Frame = +3 Query: 96 FYTT--DTNLFKRISSVGDQTVSVVPLLQQWVIEEERSVTEDKLNNFIKYLKARKRFKHA 269 FY+T +L++RIS VGD +SV PLL QWV+ E V +D+L + IK L+ KRFKHA Sbjct: 22 FYSTVVKDSLYRRISPVGDPNISVTPLLDQWVL-ESGLVQQDELRHIIKELRVYKRFKHA 80 Query: 270 LE 275 LE Sbjct: 81 LE 82 >ref|XP_004146650.1| PREDICTED: pentatricopeptide repeat-containing protein At2g20710, mitochondrial-like [Cucumis sativus] Length = 222 Score = 61.6 bits (148), Expect = 6e-08 Identities = 33/62 (53%), Positives = 43/62 (69%), Gaps = 2/62 (3%) Frame = +3 Query: 96 FYTT--DTNLFKRISSVGDQTVSVVPLLQQWVIEEERSVTEDKLNNFIKYLKARKRFKHA 269 FY+T +L++RIS VGD +SV PLL QWV+ E V +D+L + IK L+ KRFKHA Sbjct: 22 FYSTVVKDSLYRRISPVGDPNISVTPLLDQWVL-ESGLVQQDELRHIIKELRVYKRFKHA 80 Query: 270 LE 275 LE Sbjct: 81 LE 82 >ref|XP_002531596.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223528792|gb|EEF30799.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 300 Score = 60.5 bits (145), Expect = 1e-07 Identities = 31/53 (58%), Positives = 40/53 (75%) Frame = +3 Query: 117 LFKRISSVGDQTVSVVPLLQQWVIEEERSVTEDKLNNFIKYLKARKRFKHALE 275 L++RIS VGD VS+VP+L QW IEE +SV +D+L FIK L+ KR+ HALE Sbjct: 51 LYRRISPVGDPKVSIVPILDQW-IEEGKSVNKDQLQVFIKELRYCKRYTHALE 102