BLASTX nr result
ID: Coptis21_contig00016124
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis21_contig00016124 (648 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003602649.1| hypothetical protein MTR_3g096600 [Medicago ... 57 2e-06 ref|XP_003597432.1| hypothetical protein MTR_2g097990 [Medicago ... 55 9e-06 >ref|XP_003602649.1| hypothetical protein MTR_3g096600 [Medicago truncatula] gi|355491697|gb|AES72900.1| hypothetical protein MTR_3g096600 [Medicago truncatula] Length = 116 Score = 57.4 bits (137), Expect = 2e-06 Identities = 27/51 (52%), Positives = 36/51 (70%) Frame = -3 Query: 154 FGVGEAANSAAATKVEKHEGASVANQHCFVPFAFDTLRFFTLKALELLSKL 2 F VG+AA A++KV KHE A NQH F+PFAFDT F T +A++LL ++ Sbjct: 38 FTVGQAALKVASSKVAKHEKACSENQHAFIPFAFDTFGFLTPEAVDLLHRV 88 >ref|XP_003597432.1| hypothetical protein MTR_2g097990 [Medicago truncatula] gi|355486480|gb|AES67683.1| hypothetical protein MTR_2g097990 [Medicago truncatula] Length = 289 Score = 55.5 bits (132), Expect = 9e-06 Identities = 27/51 (52%), Positives = 36/51 (70%) Frame = -3 Query: 154 FGVGEAANSAAATKVEKHEGASVANQHCFVPFAFDTLRFFTLKALELLSKL 2 F VG+AA AA++KV KHE A NQH F+PFAFDT F +A++LL ++ Sbjct: 211 FIVGQAALKAASSKVVKHEKACSDNQHAFIPFAFDTFGFLAPEAVDLLHRV 261