BLASTX nr result
ID: Coptis21_contig00015046
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis21_contig00015046 (223 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002453858.1| hypothetical protein SORBIDRAFT_04g019730 [S... 57 1e-06 >ref|XP_002453858.1| hypothetical protein SORBIDRAFT_04g019730 [Sorghum bicolor] gi|241933689|gb|EES06834.1| hypothetical protein SORBIDRAFT_04g019730 [Sorghum bicolor] Length = 531 Score = 57.4 bits (137), Expect = 1e-06 Identities = 27/52 (51%), Positives = 34/52 (65%) Frame = -2 Query: 207 ENMGLKPIELAAQNEYHRDVEYLFPVTSCIPTCSDWSITGLMKYAHSEQAKK 52 + G PIE AA+ DVE LFPVTS IPT +DWS+ G++ YA S+ A K Sbjct: 347 DGFGFTPIETAARYNRREDVEILFPVTSRIPTVNDWSVDGIISYAKSKPALK 398