BLASTX nr result
ID: Coptis21_contig00014873
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis21_contig00014873 (221 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004170962.1| PREDICTED: chlorophyll a-b binding protein o... 75 7e-12 ref|XP_004155624.1| PREDICTED: chlorophyll a-b binding protein o... 75 7e-12 ref|XP_004148579.1| PREDICTED: chlorophyll a-b binding protein 3... 75 7e-12 ref|XP_004145734.1| PREDICTED: chlorophyll a-b binding protein, ... 75 7e-12 ref|XP_004134608.1| PREDICTED: chlorophyll a-b binding protein o... 75 7e-12 >ref|XP_004170962.1| PREDICTED: chlorophyll a-b binding protein of LHCII type I, chloroplastic-like [Cucumis sativus] Length = 265 Score = 74.7 bits (182), Expect = 7e-12 Identities = 33/33 (100%), Positives = 33/33 (100%) Frame = -2 Query: 220 VTGKGPLENLADHLADPVNNNAWAYATNFVPGK 122 VTGKGPLENLADHLADPVNNNAWAYATNFVPGK Sbjct: 233 VTGKGPLENLADHLADPVNNNAWAYATNFVPGK 265 >ref|XP_004155624.1| PREDICTED: chlorophyll a-b binding protein of LHCII type I, chloroplastic-like [Cucumis sativus] Length = 153 Score = 74.7 bits (182), Expect = 7e-12 Identities = 33/33 (100%), Positives = 33/33 (100%) Frame = -2 Query: 220 VTGKGPLENLADHLADPVNNNAWAYATNFVPGK 122 VTGKGPLENLADHLADPVNNNAWAYATNFVPGK Sbjct: 121 VTGKGPLENLADHLADPVNNNAWAYATNFVPGK 153 >ref|XP_004148579.1| PREDICTED: chlorophyll a-b binding protein 3C, chloroplastic-like [Cucumis sativus] gi|449518125|ref|XP_004166094.1| PREDICTED: chlorophyll a-b binding protein 3C, chloroplastic-like [Cucumis sativus] Length = 265 Score = 74.7 bits (182), Expect = 7e-12 Identities = 33/33 (100%), Positives = 33/33 (100%) Frame = -2 Query: 220 VTGKGPLENLADHLADPVNNNAWAYATNFVPGK 122 VTGKGPLENLADHLADPVNNNAWAYATNFVPGK Sbjct: 233 VTGKGPLENLADHLADPVNNNAWAYATNFVPGK 265 >ref|XP_004145734.1| PREDICTED: chlorophyll a-b binding protein, chloroplastic-like [Cucumis sativus] gi|449525484|ref|XP_004169747.1| PREDICTED: chlorophyll a-b binding protein, chloroplastic-like [Cucumis sativus] Length = 267 Score = 74.7 bits (182), Expect = 7e-12 Identities = 33/33 (100%), Positives = 33/33 (100%) Frame = -2 Query: 220 VTGKGPLENLADHLADPVNNNAWAYATNFVPGK 122 VTGKGPLENLADHLADPVNNNAWAYATNFVPGK Sbjct: 235 VTGKGPLENLADHLADPVNNNAWAYATNFVPGK 267 >ref|XP_004134608.1| PREDICTED: chlorophyll a-b binding protein of LHCII type I, chloroplastic-like [Cucumis sativus] Length = 265 Score = 74.7 bits (182), Expect = 7e-12 Identities = 33/33 (100%), Positives = 33/33 (100%) Frame = -2 Query: 220 VTGKGPLENLADHLADPVNNNAWAYATNFVPGK 122 VTGKGPLENLADHLADPVNNNAWAYATNFVPGK Sbjct: 233 VTGKGPLENLADHLADPVNNNAWAYATNFVPGK 265