BLASTX nr result
ID: Coptis21_contig00014218
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis21_contig00014218 (707 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|BAK01250.1| predicted protein [Hordeum vulgare subsp. vulgare] 60 4e-07 ref|XP_002314947.1| predicted protein [Populus trichocarpa] gi|2... 59 1e-06 gb|AEQ61823.1| 4Fe-4S ferredoxin iron-sulfur binding protein [Di... 57 3e-06 >dbj|BAK01250.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 418 Score = 60.1 bits (144), Expect = 4e-07 Identities = 28/45 (62%), Positives = 37/45 (82%) Frame = -3 Query: 705 IVGRVLHKMQSQLDVIHVEEHPEYLLEALREAIALVGTVKCYNKL 571 IVGRVL K+ S+L +H+E+HP YLLEAL+EA++LVG VK Y+ L Sbjct: 372 IVGRVLRKIPSELGRVHIEDHPAYLLEALQEALSLVGPVKGYSAL 416 >ref|XP_002314947.1| predicted protein [Populus trichocarpa] gi|222863987|gb|EEF01118.1| predicted protein [Populus trichocarpa] Length = 410 Score = 58.9 bits (141), Expect = 1e-06 Identities = 26/43 (60%), Positives = 36/43 (83%) Frame = -3 Query: 705 IVGRVLHKMQSQLDVIHVEEHPEYLLEALREAIALVGTVKCYN 577 IVGRVL M+SQ ++H+E++PE+LL+AL A+ LVGTVKCY+ Sbjct: 365 IVGRVLSSMRSQHGLVHIEDYPEHLLQALANALDLVGTVKCYD 407 >gb|AEQ61823.1| 4Fe-4S ferredoxin iron-sulfur binding protein [Dimocarpus longan] Length = 109 Score = 57.4 bits (137), Expect = 3e-06 Identities = 26/43 (60%), Positives = 36/43 (83%) Frame = -3 Query: 705 IVGRVLHKMQSQLDVIHVEEHPEYLLEALREAIALVGTVKCYN 577 IVG VL+ +QSQ + +E+HP++LLEAL+ A+ALVGTVKCY+ Sbjct: 61 IVGMVLNSLQSQHGLALIEDHPDHLLEALQHALALVGTVKCYD 103