BLASTX nr result
ID: Coptis21_contig00013833
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis21_contig00013833 (316 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002527490.1| conserved hypothetical protein [Ricinus comm... 66 3e-09 ref|XP_002521818.1| conserved hypothetical protein [Ricinus comm... 62 4e-08 ref|XP_002527491.1| conserved hypothetical protein [Ricinus comm... 62 4e-08 >ref|XP_002527490.1| conserved hypothetical protein [Ricinus communis] gi|223533130|gb|EEF34888.1| conserved hypothetical protein [Ricinus communis] Length = 60 Score = 66.2 bits (160), Expect = 3e-09 Identities = 34/51 (66%), Positives = 36/51 (70%) Frame = -1 Query: 217 ARSKLRVGPRGLGEGLDHVVPRVEGTASVWFHRAAKTSRSRRWKDNESVAP 65 ARSKLRV P GLGEG + PR EGTA WFHRAA TS S +WKDN V P Sbjct: 5 ARSKLRVDPCGLGEGPGSMGPRAEGTALGWFHRAAITSLSWQWKDNGPVLP 55 >ref|XP_002521818.1| conserved hypothetical protein [Ricinus communis] gi|223539031|gb|EEF40628.1| conserved hypothetical protein [Ricinus communis] Length = 78 Score = 62.4 bits (150), Expect = 4e-08 Identities = 32/47 (68%), Positives = 34/47 (72%) Frame = -2 Query: 219 LPVPS*ELVLVD*AKAWTTWFLEWRVLRQSGFTEQRKPPALDGGRIT 79 LP PS EL V AK TT LEWRVLR++GFTEQR PPALD G IT Sbjct: 11 LPAPSGELSFVVLAKVGTTLLLEWRVLREAGFTEQRSPPALDSGWIT 57 >ref|XP_002527491.1| conserved hypothetical protein [Ricinus communis] gi|223533131|gb|EEF34889.1| conserved hypothetical protein [Ricinus communis] Length = 101 Score = 62.4 bits (150), Expect = 4e-08 Identities = 42/89 (47%), Positives = 48/89 (53%), Gaps = 5/89 (5%) Frame = +2 Query: 62 LWSNRLVILPPSRAGGFRCSVKPD*RSTLHSRNHVVQAFA*STRTNS*LGTGKSVCSNHK 241 L ++LVILP RAGG RCSVKP R L SRN V AFA G++ H+ Sbjct: 14 LGRHQLVILPLPRAGGCRCSVKPASRCALRSRNQVTPAFAQGHIAQLSAWNGRARAQPHQ 73 Query: 242 -----PDQEP*GPCSITLMPSLELQAHAT 313 P+Q P ITLMP L LQAHAT Sbjct: 74 GRPTGPEQRP-----ITLMPLLRLQAHAT 97