BLASTX nr result
ID: Coptis21_contig00013694
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis21_contig00013694 (868 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002303498.1| predicted protein [Populus trichocarpa] gi|2... 67 4e-09 ref|XP_002526514.1| auxin:hydrogen symporter, putative [Ricinus ... 66 1e-08 ref|XP_002263557.2| PREDICTED: uncharacterized protein LOC100249... 65 2e-08 ref|XP_002317634.1| auxin efflux carrier family protein [Populus... 65 2e-08 emb|CBI37492.3| unnamed protein product [Vitis vinifera] 65 2e-08 >ref|XP_002303498.1| predicted protein [Populus trichocarpa] gi|222840930|gb|EEE78477.1| predicted protein [Populus trichocarpa] Length = 370 Score = 67.4 bits (163), Expect = 4e-09 Identities = 31/44 (70%), Positives = 36/44 (81%) Frame = +1 Query: 688 FYILKPALVFSSLAKTLTLHTLVTLWFMPLNRLITFFFGSILGW 819 FY+L PALV SSLAK +TL +L+ LWFMPLN LITF GS+LGW Sbjct: 48 FYVLSPALVGSSLAKFVTLRSLLELWFMPLNVLITFIIGSVLGW 91 >ref|XP_002526514.1| auxin:hydrogen symporter, putative [Ricinus communis] gi|223534189|gb|EEF35905.1| auxin:hydrogen symporter, putative [Ricinus communis] Length = 434 Score = 65.9 bits (159), Expect = 1e-08 Identities = 29/44 (65%), Positives = 35/44 (79%) Frame = +1 Query: 688 FYILKPALVFSSLAKTLTLHTLVTLWFMPLNRLITFFFGSILGW 819 FY+ PAL+ SSLA T+TL +LVTLWFMP+N L+TF GS LGW Sbjct: 80 FYVFSPALIGSSLANTVTLDSLVTLWFMPVNILLTFIIGSALGW 123 >ref|XP_002263557.2| PREDICTED: uncharacterized protein LOC100249991 [Vitis vinifera] Length = 365 Score = 65.1 bits (157), Expect = 2e-08 Identities = 28/44 (63%), Positives = 35/44 (79%) Frame = +1 Query: 688 FYILKPALVFSSLAKTLTLHTLVTLWFMPLNRLITFFFGSILGW 819 FY+ PALV S+LAKT+T +LVT+WFMP+N L+TF GS LGW Sbjct: 48 FYVFNPALVSSNLAKTITFSSLVTMWFMPVNILLTFVIGSALGW 91 >ref|XP_002317634.1| auxin efflux carrier family protein [Populus trichocarpa] gi|222860699|gb|EEE98246.1| auxin efflux carrier family protein [Populus trichocarpa] Length = 390 Score = 65.1 bits (157), Expect = 2e-08 Identities = 33/54 (61%), Positives = 39/54 (72%), Gaps = 3/54 (5%) Frame = +1 Query: 688 FYILKPALVFSSLAKTLTLHTLVTLWFMPLNRLITFFFGSILGW---KFGDAPV 840 FY+L PALV S+LAK +TL ++V LWFMPLN LITF GS LGW K AP+ Sbjct: 48 FYVLNPALVGSNLAKFITLKSIVMLWFMPLNILITFIAGSALGWLLIKITKAPI 101 >emb|CBI37492.3| unnamed protein product [Vitis vinifera] Length = 418 Score = 65.1 bits (157), Expect = 2e-08 Identities = 28/44 (63%), Positives = 35/44 (79%) Frame = +1 Query: 688 FYILKPALVFSSLAKTLTLHTLVTLWFMPLNRLITFFFGSILGW 819 FY+ PALV S+LAKT+T +LVT+WFMP+N L+TF GS LGW Sbjct: 48 FYVFNPALVSSNLAKTITFSSLVTMWFMPVNILLTFVIGSALGW 91