BLASTX nr result
ID: Coptis21_contig00013677
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis21_contig00013677 (327 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004168984.1| PREDICTED: pentatricopeptide repeat-containi... 80 2e-13 ref|XP_004146598.1| PREDICTED: pentatricopeptide repeat-containi... 80 2e-13 ref|XP_002869870.1| hypothetical protein ARALYDRAFT_354609 [Arab... 78 7e-13 ref|XP_002531596.1| pentatricopeptide repeat-containing protein,... 74 2e-11 emb|CBI21840.3| unnamed protein product [Vitis vinifera] 69 5e-10 >ref|XP_004168984.1| PREDICTED: pentatricopeptide repeat-containing protein At2g20710, mitochondrial-like [Cucumis sativus] Length = 461 Score = 80.1 bits (196), Expect = 2e-13 Identities = 37/66 (56%), Positives = 50/66 (75%) Frame = +1 Query: 130 LYKRIVPLAGQKVSMISILEQWREEGRFFRKHELVAIIKELRVFKRFKHALEISQWMTEQ 309 LY+RI P+ +S+ +L+QW EGR ++ EL IIKELRV+KRFKHALEIS+WM+++ Sbjct: 31 LYRRISPVGDPNISVTPLLDQWVLEGRLVQQDELRHIIKELRVYKRFKHALEISKWMSDK 90 Query: 310 SYIPLS 327 Y PLS Sbjct: 91 RYFPLS 96 >ref|XP_004146598.1| PREDICTED: pentatricopeptide repeat-containing protein At2g20710, mitochondrial-like [Cucumis sativus] Length = 227 Score = 80.1 bits (196), Expect = 2e-13 Identities = 37/66 (56%), Positives = 50/66 (75%) Frame = +1 Query: 130 LYKRIVPLAGQKVSMISILEQWREEGRFFRKHELVAIIKELRVFKRFKHALEISQWMTEQ 309 LY+RI P+ +S+ +L+QW EGR ++ EL IIKELRV+KRFKHALEIS+WM+++ Sbjct: 31 LYRRISPVGDPNISVTPLLDQWVLEGRLVQQDELRHIIKELRVYKRFKHALEISKWMSDK 90 Query: 310 SYIPLS 327 Y PLS Sbjct: 91 RYFPLS 96 >ref|XP_002869870.1| hypothetical protein ARALYDRAFT_354609 [Arabidopsis lyrata subsp. lyrata] gi|297315706|gb|EFH46129.1| hypothetical protein ARALYDRAFT_354609 [Arabidopsis lyrata subsp. lyrata] Length = 480 Score = 78.2 bits (191), Expect = 7e-13 Identities = 34/66 (51%), Positives = 49/66 (74%) Frame = +1 Query: 130 LYKRIVPLAGQKVSMISILEQWREEGRFFRKHELVAIIKELRVFKRFKHALEISQWMTEQ 309 LYKRI PL K+S++ +L++WR EG + K EL +IKEL +KRF HALE+S+WM+++ Sbjct: 38 LYKRISPLGDPKISIVPVLDEWRGEGNYTSKEELRGMIKELIKYKRFVHALEVSRWMSDR 97 Query: 310 SYIPLS 327 + PLS Sbjct: 98 MFFPLS 103 >ref|XP_002531596.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223528792|gb|EEF30799.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 300 Score = 73.6 bits (179), Expect = 2e-11 Identities = 34/66 (51%), Positives = 46/66 (69%) Frame = +1 Query: 130 LYKRIVPLAGQKVSMISILEQWREEGRFFRKHELVAIIKELRVFKRFKHALEISQWMTEQ 309 LY+RI P+ KVS++ IL+QW EEG+ K +L IKELR KR+ HALEIS WM+++ Sbjct: 51 LYRRISPVGDPKVSIVPILDQWIEEGKSVNKDQLQVFIKELRYCKRYTHALEISMWMSDK 110 Query: 310 SYIPLS 327 Y L+ Sbjct: 111 RYFALT 116 >emb|CBI21840.3| unnamed protein product [Vitis vinifera] Length = 446 Score = 68.6 bits (166), Expect = 5e-10 Identities = 30/68 (44%), Positives = 47/68 (69%) Frame = +1 Query: 124 EALYKRIVPLAGQKVSMISILEQWREEGRFFRKHELVAIIKELRVFKRFKHALEISQWMT 303 E+L RI P +VS++ LEQWR+EGR ++ +L +I++LR FKR+ HALEI +W+ Sbjct: 35 ESLQSRISPAIDLRVSIVPALEQWRKEGRSIKQQDLHRLIRKLRTFKRYNHALEIYEWIR 94 Query: 304 EQSYIPLS 327 ++ Y +S Sbjct: 95 DKFYFDIS 102