BLASTX nr result
ID: Coptis21_contig00013527
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis21_contig00013527 (253 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AFK34102.1| unknown [Lotus japonicus] 79 3e-13 gb|AFH68079.1| thioredoxin-like protein 2.1 [Populus tremula x P... 78 7e-13 ref|NP_001239801.1| uncharacterized protein LOC100783648 [Glycin... 78 9e-13 emb|CBI30002.3| unnamed protein product [Vitis vinifera] 77 1e-12 ref|XP_002275794.1| PREDICTED: thioredoxin-like 3-1, chloroplast... 77 1e-12 >gb|AFK34102.1| unknown [Lotus japonicus] Length = 187 Score = 79.3 bits (194), Expect = 3e-13 Identities = 36/38 (94%), Positives = 37/38 (97%) Frame = +1 Query: 1 KMPTIQLWKDGEMKEEVIGGHKAWLVIDEVREMIQKFI 114 KMPTIQLWKDGEMKEEVIGGHK WLVI+EVREMIQKFI Sbjct: 150 KMPTIQLWKDGEMKEEVIGGHKGWLVIEEVREMIQKFI 187 >gb|AFH68079.1| thioredoxin-like protein 2.1 [Populus tremula x Populus tremuloides] Length = 121 Score = 78.2 bits (191), Expect = 7e-13 Identities = 35/38 (92%), Positives = 37/38 (97%) Frame = +1 Query: 1 KMPTIQLWKDGEMKEEVIGGHKAWLVIDEVREMIQKFI 114 KMPTIQLWKDGEMK EVIGGHKAWLVI+EVREMIQKF+ Sbjct: 84 KMPTIQLWKDGEMKAEVIGGHKAWLVIEEVREMIQKFV 121 >ref|NP_001239801.1| uncharacterized protein LOC100783648 [Glycine max] gi|255640849|gb|ACU20707.1| unknown [Glycine max] Length = 189 Score = 77.8 bits (190), Expect = 9e-13 Identities = 34/38 (89%), Positives = 38/38 (100%) Frame = +1 Query: 1 KMPTIQLWKDGEMKEEVIGGHKAWLVIDEVREMIQKFI 114 KMPTIQLWKDGEMKEEVIGGHKAWLVI+EV+EMIQK++ Sbjct: 152 KMPTIQLWKDGEMKEEVIGGHKAWLVIEEVKEMIQKYL 189 >emb|CBI30002.3| unnamed protein product [Vitis vinifera] Length = 113 Score = 77.4 bits (189), Expect = 1e-12 Identities = 34/38 (89%), Positives = 37/38 (97%) Frame = +1 Query: 1 KMPTIQLWKDGEMKEEVIGGHKAWLVIDEVREMIQKFI 114 KMPTIQLWKDGEMK EVIGGHKAW+VIDEVREMI+KF+ Sbjct: 76 KMPTIQLWKDGEMKAEVIGGHKAWIVIDEVREMIKKFV 113 >ref|XP_002275794.1| PREDICTED: thioredoxin-like 3-1, chloroplastic isoform 1 [Vitis vinifera] Length = 185 Score = 77.4 bits (189), Expect = 1e-12 Identities = 34/38 (89%), Positives = 37/38 (97%) Frame = +1 Query: 1 KMPTIQLWKDGEMKEEVIGGHKAWLVIDEVREMIQKFI 114 KMPTIQLWKDGEMK EVIGGHKAW+VIDEVREMI+KF+ Sbjct: 148 KMPTIQLWKDGEMKAEVIGGHKAWIVIDEVREMIKKFV 185