BLASTX nr result
ID: Coptis21_contig00013428
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis21_contig00013428 (371 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002283329.1| PREDICTED: probable plastid-lipid-associated... 229 2e-58 ref|XP_003556560.1| PREDICTED: probable plastid-lipid-associated... 225 3e-57 ref|XP_003592813.1| hypothetical protein MTR_1g116320 [Medicago ... 223 1e-56 ref|XP_002528121.1| structural molecule, putative [Ricinus commu... 222 3e-56 ref|XP_002297657.1| predicted protein [Populus trichocarpa] gi|2... 220 1e-55 >ref|XP_002283329.1| PREDICTED: probable plastid-lipid-associated protein 12, chloroplastic [Vitis vinifera] gi|297746405|emb|CBI16461.3| unnamed protein product [Vitis vinifera] Length = 396 Score = 229 bits (583), Expect = 2e-58 Identities = 112/123 (91%), Positives = 118/123 (95%) Frame = -1 Query: 371 LIFTTRPGTASPIQRTFVGVDVFNVFQEVYLRTEDPRVSNIVQFSDAVGELKVEAAASIN 192 L+FTTRPGTASPIQRTFVGVD FNVFQEVYLRT+DPRVSNIV+FS+A+GELKVEAAASI Sbjct: 117 LMFTTRPGTASPIQRTFVGVDNFNVFQEVYLRTDDPRVSNIVRFSEAIGELKVEAAASIK 176 Query: 191 SGTRILFRFDRAAFSLKFLPFKVPYPVPFRLLGDEAKGWLDTTYLSQSGNIRISRGNKGT 12 G RILFRFDRAAFS KFLPFKVPYPVPFRLLGDEAKGWLDTTYLSQSGN+RISRGNKGT Sbjct: 177 DGKRILFRFDRAAFSFKFLPFKVPYPVPFRLLGDEAKGWLDTTYLSQSGNLRISRGNKGT 236 Query: 11 TFV 3 TFV Sbjct: 237 TFV 239 >ref|XP_003556560.1| PREDICTED: probable plastid-lipid-associated protein 12, chloroplastic-like [Glycine max] Length = 377 Score = 225 bits (574), Expect = 3e-57 Identities = 111/123 (90%), Positives = 114/123 (92%) Frame = -1 Query: 371 LIFTTRPGTASPIQRTFVGVDVFNVFQEVYLRTEDPRVSNIVQFSDAVGELKVEAAASIN 192 LIFTTRPGTASPIQRTFVGVD F+VFQEVYLRT DPRV NIV FSDA+GELKVEAAASI Sbjct: 94 LIFTTRPGTASPIQRTFVGVDFFSVFQEVYLRTNDPRVCNIVSFSDAIGELKVEAAASIE 153 Query: 191 SGTRILFRFDRAAFSLKFLPFKVPYPVPFRLLGDEAKGWLDTTYLSQSGNIRISRGNKGT 12 G RILFRFDRAAFS KFLPFKVPYPVPFRLLGDEAKGWLDTTYLS SGN+RISRGNKGT Sbjct: 154 DGKRILFRFDRAAFSFKFLPFKVPYPVPFRLLGDEAKGWLDTTYLSSSGNLRISRGNKGT 213 Query: 11 TFV 3 TFV Sbjct: 214 TFV 216 >ref|XP_003592813.1| hypothetical protein MTR_1g116320 [Medicago truncatula] gi|355481861|gb|AES63064.1| hypothetical protein MTR_1g116320 [Medicago truncatula] Length = 388 Score = 223 bits (569), Expect = 1e-56 Identities = 109/123 (88%), Positives = 115/123 (93%) Frame = -1 Query: 371 LIFTTRPGTASPIQRTFVGVDVFNVFQEVYLRTEDPRVSNIVQFSDAVGELKVEAAASIN 192 LIFTTRPGTASPIQRTFVGVD F+VFQEVYL+T DPRV+NIV FSDA+GELKVEAAASI Sbjct: 106 LIFTTRPGTASPIQRTFVGVDFFSVFQEVYLQTNDPRVTNIVSFSDAIGELKVEAAASIG 165 Query: 191 SGTRILFRFDRAAFSLKFLPFKVPYPVPFRLLGDEAKGWLDTTYLSQSGNIRISRGNKGT 12 G RILFRFDRAAFS KFLPFKVPYPVPF+LLGDEAKGWLDTTYLS SGN+RISRGNKGT Sbjct: 166 DGKRILFRFDRAAFSFKFLPFKVPYPVPFKLLGDEAKGWLDTTYLSHSGNLRISRGNKGT 225 Query: 11 TFV 3 TFV Sbjct: 226 TFV 228 >ref|XP_002528121.1| structural molecule, putative [Ricinus communis] gi|223532460|gb|EEF34251.1| structural molecule, putative [Ricinus communis] Length = 409 Score = 222 bits (565), Expect = 3e-56 Identities = 107/123 (86%), Positives = 117/123 (95%) Frame = -1 Query: 371 LIFTTRPGTASPIQRTFVGVDVFNVFQEVYLRTEDPRVSNIVQFSDAVGELKVEAAASIN 192 L+FTTRPGTASPIQRTFVGVD F+VFQEVYL+T DPRVSNIV+FSD +GELKVEAAA+I Sbjct: 124 LMFTTRPGTASPIQRTFVGVDFFSVFQEVYLQTNDPRVSNIVRFSDVIGELKVEAAAAIE 183 Query: 191 SGTRILFRFDRAAFSLKFLPFKVPYPVPFRLLGDEAKGWLDTTYLSQSGNIRISRGNKGT 12 +G RI+FRFDRAAFSL+FLPFKVPYPVPFRLLGDEAKGWLDTTYLS SGN+RISRGNKGT Sbjct: 184 NGKRIIFRFDRAAFSLRFLPFKVPYPVPFRLLGDEAKGWLDTTYLSPSGNLRISRGNKGT 243 Query: 11 TFV 3 TFV Sbjct: 244 TFV 246 >ref|XP_002297657.1| predicted protein [Populus trichocarpa] gi|222844915|gb|EEE82462.1| predicted protein [Populus trichocarpa] Length = 399 Score = 220 bits (560), Expect = 1e-55 Identities = 107/123 (86%), Positives = 116/123 (94%) Frame = -1 Query: 371 LIFTTRPGTASPIQRTFVGVDVFNVFQEVYLRTEDPRVSNIVQFSDAVGELKVEAAASIN 192 L+FTTRPGTASPIQRTFVGVD F+VFQEVYLRT DPRVSNIV+FS+A+GELKVEAAA+I Sbjct: 114 LMFTTRPGTASPIQRTFVGVDFFSVFQEVYLRTNDPRVSNIVKFSNAIGELKVEAAATIE 173 Query: 191 SGTRILFRFDRAAFSLKFLPFKVPYPVPFRLLGDEAKGWLDTTYLSQSGNIRISRGNKGT 12 +G RILF+FDRAAFS FLPFKVPYPVPFRLLGDEAKGWLDTTYLS SGN+RISRGNKGT Sbjct: 174 NGKRILFQFDRAAFSFNFLPFKVPYPVPFRLLGDEAKGWLDTTYLSPSGNLRISRGNKGT 233 Query: 11 TFV 3 TFV Sbjct: 234 TFV 236