BLASTX nr result
ID: Coptis21_contig00012901
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis21_contig00012901 (309 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004150403.1| PREDICTED: 40S ribosomal protein S15-like [C... 71 1e-10 ref|XP_004134098.1| PREDICTED: 40S ribosomal protein S15-like [C... 71 1e-10 gb|EMC93216.1| hypothetical protein BAUCODRAFT_36884 [Baudoinia ... 71 1e-10 gb|ELA35313.1| 40s ribosomal protein s15 [Colletotrichum gloeosp... 71 1e-10 gb|EKV09366.1| 40S ribosomal protein S15, putative [Penicillium ... 71 1e-10 >ref|XP_004150403.1| PREDICTED: 40S ribosomal protein S15-like [Cucumis sativus] gi|449530802|ref|XP_004172381.1| PREDICTED: 40S ribosomal protein S15-like isoform 1 [Cucumis sativus] gi|449530804|ref|XP_004172382.1| PREDICTED: 40S ribosomal protein S15-like isoform 2 [Cucumis sativus] Length = 153 Score = 70.9 bits (172), Expect = 1e-10 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = -3 Query: 307 HYLAEFSISYKPVKHGRPGIGATHSSRFIPLK 212 HYLAEFSISYKPVKHGRPGIGATHSSRFIPLK Sbjct: 122 HYLAEFSISYKPVKHGRPGIGATHSSRFIPLK 153 >ref|XP_004134098.1| PREDICTED: 40S ribosomal protein S15-like [Cucumis sativus] gi|449504095|ref|XP_004162251.1| PREDICTED: 40S ribosomal protein S15-like [Cucumis sativus] Length = 154 Score = 70.9 bits (172), Expect = 1e-10 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = -3 Query: 307 HYLAEFSISYKPVKHGRPGIGATHSSRFIPLK 212 HYLAEFSISYKPVKHGRPGIGATHSSRFIPLK Sbjct: 123 HYLAEFSISYKPVKHGRPGIGATHSSRFIPLK 154 >gb|EMC93216.1| hypothetical protein BAUCODRAFT_36884 [Baudoinia compniacensis UAMH 10762] Length = 92 Score = 70.9 bits (172), Expect = 1e-10 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = -3 Query: 307 HYLAEFSISYKPVKHGRPGIGATHSSRFIPLK 212 HYLAEFSISYKPVKHGRPGIGATHSSRFIPLK Sbjct: 61 HYLAEFSISYKPVKHGRPGIGATHSSRFIPLK 92 >gb|ELA35313.1| 40s ribosomal protein s15 [Colletotrichum gloeosporioides Nara gc5] Length = 153 Score = 70.9 bits (172), Expect = 1e-10 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = -3 Query: 307 HYLAEFSISYKPVKHGRPGIGATHSSRFIPLK 212 HYLAEFSISYKPVKHGRPGIGATHSSRFIPLK Sbjct: 122 HYLAEFSISYKPVKHGRPGIGATHSSRFIPLK 153 >gb|EKV09366.1| 40S ribosomal protein S15, putative [Penicillium digitatum Pd1] gi|425776723|gb|EKV14931.1| 40S ribosomal protein S15, putative [Penicillium digitatum PHI26] Length = 153 Score = 70.9 bits (172), Expect = 1e-10 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = -3 Query: 307 HYLAEFSISYKPVKHGRPGIGATHSSRFIPLK 212 HYLAEFSISYKPVKHGRPGIGATHSSRFIPLK Sbjct: 122 HYLAEFSISYKPVKHGRPGIGATHSSRFIPLK 153