BLASTX nr result
ID: Coptis21_contig00012770
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis21_contig00012770 (683 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002519637.1| conserved hypothetical protein [Ricinus comm... 55 1e-05 >ref|XP_002519637.1| conserved hypothetical protein [Ricinus communis] gi|223541054|gb|EEF42610.1| conserved hypothetical protein [Ricinus communis] Length = 89 Score = 55.5 bits (132), Expect = 1e-05 Identities = 25/44 (56%), Positives = 34/44 (77%) Frame = +2 Query: 155 MTNSRIISFVMDTPPPQYVSVMRRKASKILDTIAEEEMNINIVN 286 M NSRI F+ + PPQY+SV+RR+ASK+LDTI EEE +++ N Sbjct: 1 MANSRIARFITEVAPPQYISVIRRRASKMLDTINEEERDVSPSN 44