BLASTX nr result
ID: Coptis21_contig00012716
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis21_contig00012716 (393 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002269622.2| PREDICTED: uncharacterized protein LOC100247... 87 1e-15 ref|XP_002325450.1| predicted protein [Populus trichocarpa] gi|2... 80 2e-13 ref|XP_002319776.1| predicted protein [Populus trichocarpa] gi|2... 79 3e-13 ref|XP_002524051.1| conserved hypothetical protein [Ricinus comm... 79 5e-13 ref|XP_004158611.1| PREDICTED: LOW QUALITY PROTEIN: uncharacteri... 77 2e-12 >ref|XP_002269622.2| PREDICTED: uncharacterized protein LOC100247776 [Vitis vinifera] gi|297737261|emb|CBI26462.3| unnamed protein product [Vitis vinifera] Length = 338 Score = 87.4 bits (215), Expect = 1e-15 Identities = 41/51 (80%), Positives = 45/51 (88%) Frame = +3 Query: 231 MKPRRNGNPSAHKARSLQGEGPNWVLIAGGALLSTLSIRLGYKLKQVLDTR 383 MKPR NG P A K+R+ QGEGPNWVL+AGGALLSTLSIRLGYKLKQ LDT+ Sbjct: 1 MKPRTNGVPRAQKSRNFQGEGPNWVLLAGGALLSTLSIRLGYKLKQALDTK 51 >ref|XP_002325450.1| predicted protein [Populus trichocarpa] gi|222862325|gb|EEE99831.1| predicted protein [Populus trichocarpa] Length = 326 Score = 80.1 bits (196), Expect = 2e-13 Identities = 38/51 (74%), Positives = 42/51 (82%) Frame = +3 Query: 231 MKPRRNGNPSAHKARSLQGEGPNWVLIAGGALLSTLSIRLGYKLKQVLDTR 383 MKPR NG KA++ QGEG NW+LIAGGALLSTLSIRLGYKLKQ LD+R Sbjct: 1 MKPRTNGTSRGQKAQNFQGEGRNWILIAGGALLSTLSIRLGYKLKQTLDSR 51 >ref|XP_002319776.1| predicted protein [Populus trichocarpa] gi|222858152|gb|EEE95699.1| predicted protein [Populus trichocarpa] Length = 291 Score = 79.3 bits (194), Expect = 3e-13 Identities = 37/51 (72%), Positives = 42/51 (82%) Frame = +3 Query: 231 MKPRRNGNPSAHKARSLQGEGPNWVLIAGGALLSTLSIRLGYKLKQVLDTR 383 MKPR NG KA++ QGE PNW+LIAGGALLSTLSIRLGYKLKQ LD++ Sbjct: 1 MKPRTNGTSRGQKAQNFQGERPNWILIAGGALLSTLSIRLGYKLKQTLDSK 51 >ref|XP_002524051.1| conserved hypothetical protein [Ricinus communis] gi|223536778|gb|EEF38419.1| conserved hypothetical protein [Ricinus communis] Length = 342 Score = 78.6 bits (192), Expect = 5e-13 Identities = 36/51 (70%), Positives = 41/51 (80%) Frame = +3 Query: 231 MKPRRNGNPSAHKARSLQGEGPNWVLIAGGALLSTLSIRLGYKLKQVLDTR 383 M R NG P K ++ QGEGPNW++IAGGALLSTLSIRLGYKLKQ LDT+ Sbjct: 1 MTSRTNGIPRGQKGKTFQGEGPNWIIIAGGALLSTLSIRLGYKLKQTLDTK 51 >ref|XP_004158611.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized LOC101220277 [Cucumis sativus] Length = 342 Score = 76.6 bits (187), Expect = 2e-12 Identities = 38/53 (71%), Positives = 41/53 (77%) Frame = +3 Query: 231 MKPRRNGNPSAHKARSLQGEGPNWVLIAGGALLSTLSIRLGYKLKQVLDTRGL 389 M PR + +P A K+R EGPNWVLIAGGALLSTLSIRLGYKLKQ DTR L Sbjct: 1 MTPRTSRSPRAQKSRISSNEGPNWVLIAGGALLSTLSIRLGYKLKQAFDTRQL 53