BLASTX nr result
ID: Coptis21_contig00012626
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis21_contig00012626 (1450 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_001078399.1| hyaluronan / mRNA binding domain-containing ... 71 8e-10 ref|NP_001078400.1| hyaluronan / mRNA binding domain-containing ... 71 8e-10 ref|NP_193416.1| hyaluronan / mRNA binding domain-containing pro... 71 8e-10 gb|AAM61393.1| nuclear antigen homolog [Arabidopsis thaliana] 71 8e-10 ref|XP_002870130.1| hypothetical protein ARALYDRAFT_493188 [Arab... 67 9e-09 >ref|NP_001078399.1| hyaluronan / mRNA binding domain-containing protein [Arabidopsis thaliana] gi|332658410|gb|AEE83810.1| hyaluronan / mRNA binding domain-containing protein [Arabidopsis thaliana] Length = 265 Score = 70.9 bits (172), Expect = 8e-10 Identities = 41/76 (53%), Positives = 53/76 (69%), Gaps = 5/76 (6%) Frame = +2 Query: 935 MTLNEYEKM---RKPVLSTKTTGERKVDSKGFESMKLL--KKGNHEIFVKLGSEKDGAKR 1099 MTL+EYEK+ +K L + TT ERKVD+K FESM+ L KK N EIF+KLGS+KD KR Sbjct: 136 MTLDEYEKILEEKKKALQSLTTSERKVDTKVFESMQQLSNKKSNDEIFIKLGSDKD--KR 193 Query: 1100 KEDANSKADKVKKVSQ 1147 K+D KA K +++ Sbjct: 194 KDDKEEKAKKAVSINE 209 >ref|NP_001078400.1| hyaluronan / mRNA binding domain-containing protein [Arabidopsis thaliana] gi|332658411|gb|AEE83811.1| hyaluronan / mRNA binding domain-containing protein [Arabidopsis thaliana] Length = 345 Score = 70.9 bits (172), Expect = 8e-10 Identities = 41/76 (53%), Positives = 53/76 (69%), Gaps = 5/76 (6%) Frame = +2 Query: 935 MTLNEYEKM---RKPVLSTKTTGERKVDSKGFESMKLL--KKGNHEIFVKLGSEKDGAKR 1099 MTL+EYEK+ +K L + TT ERKVD+K FESM+ L KK N EIF+KLGS+KD KR Sbjct: 216 MTLDEYEKILEEKKKALQSLTTSERKVDTKVFESMQQLSNKKSNDEIFIKLGSDKD--KR 273 Query: 1100 KEDANSKADKVKKVSQ 1147 K+D KA K +++ Sbjct: 274 KDDKEEKAKKAVSINE 289 >ref|NP_193416.1| hyaluronan / mRNA binding domain-containing protein [Arabidopsis thaliana] gi|6492264|gb|AAF14243.1|AF110227_1 nuclear RNA binding protein [Arabidopsis thaliana] gi|2245037|emb|CAB10456.1| nuclear antigen homolog [Arabidopsis thaliana] gi|7268434|emb|CAB80954.1| nuclear antigen homolog [Arabidopsis thaliana] gi|17380880|gb|AAL36252.1| putative nuclear antigen homolog [Arabidopsis thaliana] gi|20465929|gb|AAM20150.1| putative nuclear antigen-like protein [Arabidopsis thaliana] gi|22022571|gb|AAM83242.1| AT4g16830/dl4440w [Arabidopsis thaliana] gi|23308317|gb|AAN18128.1| At4g16830/dl4440w [Arabidopsis thaliana] gi|332658409|gb|AEE83809.1| hyaluronan / mRNA binding domain-containing protein [Arabidopsis thaliana] Length = 355 Score = 70.9 bits (172), Expect = 8e-10 Identities = 41/76 (53%), Positives = 53/76 (69%), Gaps = 5/76 (6%) Frame = +2 Query: 935 MTLNEYEKM---RKPVLSTKTTGERKVDSKGFESMKLL--KKGNHEIFVKLGSEKDGAKR 1099 MTL+EYEK+ +K L + TT ERKVD+K FESM+ L KK N EIF+KLGS+KD KR Sbjct: 226 MTLDEYEKILEEKKKALQSLTTSERKVDTKVFESMQQLSNKKSNDEIFIKLGSDKD--KR 283 Query: 1100 KEDANSKADKVKKVSQ 1147 K+D KA K +++ Sbjct: 284 KDDKEEKAKKAVSINE 299 >gb|AAM61393.1| nuclear antigen homolog [Arabidopsis thaliana] Length = 354 Score = 70.9 bits (172), Expect = 8e-10 Identities = 41/76 (53%), Positives = 53/76 (69%), Gaps = 5/76 (6%) Frame = +2 Query: 935 MTLNEYEKM---RKPVLSTKTTGERKVDSKGFESMKLL--KKGNHEIFVKLGSEKDGAKR 1099 MTL+EYEK+ +K L + TT ERKVD+K FESM+ L KK N EIF+KLGS+KD KR Sbjct: 225 MTLDEYEKILEEKKKALQSLTTSERKVDTKVFESMQQLSNKKSNDEIFIKLGSDKD--KR 282 Query: 1100 KEDANSKADKVKKVSQ 1147 K+D KA K +++ Sbjct: 283 KDDKEEKAKKAVSINE 298 >ref|XP_002870130.1| hypothetical protein ARALYDRAFT_493188 [Arabidopsis lyrata subsp. lyrata] gi|297315966|gb|EFH46389.1| hypothetical protein ARALYDRAFT_493188 [Arabidopsis lyrata subsp. lyrata] Length = 358 Score = 67.4 bits (163), Expect = 9e-09 Identities = 39/76 (51%), Positives = 52/76 (68%), Gaps = 5/76 (6%) Frame = +2 Query: 935 MTLNEYEKM---RKPVLSTKTTGERKVDSKGFESMKLL--KKGNHEIFVKLGSEKDGAKR 1099 MTL+EYEK+ +K L + T ERKVD+K FESM+ L KK N EIF+KLGS+KD KR Sbjct: 228 MTLDEYEKILEEKKKALQSLATSERKVDTKVFESMQQLSNKKSNDEIFIKLGSDKD--KR 285 Query: 1100 KEDANSKADKVKKVSQ 1147 K++ KA K +++ Sbjct: 286 KDEKEEKAKKAVSINE 301