BLASTX nr result
ID: Coptis21_contig00012403
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis21_contig00012403 (444 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002281998.2| PREDICTED: pentatricopeptide repeat-containi... 63 2e-08 emb|CBI20737.3| unnamed protein product [Vitis vinifera] 63 2e-08 ref|XP_004157408.1| PREDICTED: LOW QUALITY PROTEIN: pentatricope... 55 6e-06 ref|XP_004141438.1| PREDICTED: pentatricopeptide repeat-containi... 55 6e-06 >ref|XP_002281998.2| PREDICTED: pentatricopeptide repeat-containing protein At4g33170 [Vitis vinifera] Length = 1580 Score = 63.2 bits (152), Expect = 2e-08 Identities = 35/57 (61%), Positives = 44/57 (77%), Gaps = 3/57 (5%) Frame = +3 Query: 279 MNLSRKGFP--NVTLNTGIKATALNPNAAEFVPFSLRSTPGSTSPGEASA-WDTSGT 440 M+LS+KG P N+ L++ K T LNPNAAEFVPF+LRS+ GSTS G+ASA + SGT Sbjct: 1 MSLSKKGNPINNIKLDSTAKVTTLNPNAAEFVPFALRSSSGSTSTGDASARFTPSGT 57 >emb|CBI20737.3| unnamed protein product [Vitis vinifera] Length = 524 Score = 63.2 bits (152), Expect = 2e-08 Identities = 35/57 (61%), Positives = 44/57 (77%), Gaps = 3/57 (5%) Frame = +3 Query: 279 MNLSRKGFP--NVTLNTGIKATALNPNAAEFVPFSLRSTPGSTSPGEASA-WDTSGT 440 M+LS+KG P N+ L++ K T LNPNAAEFVPF+LRS+ GSTS G+ASA + SGT Sbjct: 1 MSLSKKGNPINNIKLDSTAKVTTLNPNAAEFVPFALRSSSGSTSTGDASARFTPSGT 57 >ref|XP_004157408.1| PREDICTED: LOW QUALITY PROTEIN: pentatricopeptide repeat-containing protein At4g33170-like [Cucumis sativus] Length = 1573 Score = 55.1 bits (131), Expect = 6e-06 Identities = 31/57 (54%), Positives = 41/57 (71%), Gaps = 3/57 (5%) Frame = +3 Query: 279 MNLSRKGFPN--VTLNTGIKATALNPNAAEFVPFSLRSTP-GSTSPGEASAWDTSGT 440 MN+S+KG V LN G K TALNPNAAEF+PF+LR++P GS+S + + +SGT Sbjct: 1 MNVSKKGTQTSEVKLNIGSKVTALNPNAAEFIPFALRASPVGSSSAPDLTERFSSGT 57 >ref|XP_004141438.1| PREDICTED: pentatricopeptide repeat-containing protein At4g33170-like [Cucumis sativus] Length = 1573 Score = 55.1 bits (131), Expect = 6e-06 Identities = 31/57 (54%), Positives = 41/57 (71%), Gaps = 3/57 (5%) Frame = +3 Query: 279 MNLSRKGFPN--VTLNTGIKATALNPNAAEFVPFSLRSTP-GSTSPGEASAWDTSGT 440 MN+S+KG V LN G K TALNPNAAEF+PF+LR++P GS+S + + +SGT Sbjct: 1 MNVSKKGTQTSEVKLNIGSKVTALNPNAAEFIPFALRASPVGSSSAPDLTERFSSGT 57