BLASTX nr result
ID: Coptis21_contig00012360
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis21_contig00012360 (443 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ACP18876.1| subtilisin-like serine protease [Carica papaya] 57 1e-06 ref|XP_002525017.1| Xylem serine proteinase 1 precursor, putativ... 55 8e-06 >gb|ACP18876.1| subtilisin-like serine protease [Carica papaya] Length = 771 Score = 57.4 bits (137), Expect = 1e-06 Identities = 26/34 (76%), Positives = 30/34 (88%) Frame = +3 Query: 12 SWDFLGLGKNGEVPAHSL*KKARFGEDTIMGNLD 113 SWDFLGL +NG VP+ S+ KKARFGEDTI+GNLD Sbjct: 118 SWDFLGLEQNGVVPSSSIWKKARFGEDTIIGNLD 151 >ref|XP_002525017.1| Xylem serine proteinase 1 precursor, putative [Ricinus communis] gi|223535679|gb|EEF37344.1| Xylem serine proteinase 1 precursor, putative [Ricinus communis] Length = 766 Score = 54.7 bits (130), Expect = 8e-06 Identities = 24/34 (70%), Positives = 29/34 (85%) Frame = +3 Query: 12 SWDFLGLGKNGEVPAHSL*KKARFGEDTIMGNLD 113 SW+FLGL +NG +PA+SL KARFGED I+GNLD Sbjct: 120 SWEFLGLERNGRIPANSLWLKARFGEDVIIGNLD 153