BLASTX nr result
ID: Coptis21_contig00012234
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis21_contig00012234 (369 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABD63074.1| hypothetical protein 17.t00001 [Asparagus officin... 89 3e-16 ref|XP_004143846.1| PREDICTED: UPF0160 protein-like [Cucumis sat... 89 4e-16 gb|AFK48059.1| unknown [Lotus japonicus] 87 1e-15 ref|XP_002518897.1| Protein MYG1, putative [Ricinus communis] gi... 86 2e-15 ref|NP_001241305.1| uncharacterized protein LOC100800706 [Glycin... 85 5e-15 >gb|ABD63074.1| hypothetical protein 17.t00001 [Asparagus officinalis] Length = 261 Score = 89.4 bits (220), Expect = 3e-16 Identities = 41/45 (91%), Positives = 43/45 (95%) Frame = +2 Query: 8 WRGLRDEELSKESSIPGCVFVHMSGFIGGNATYDGALAMARASLK 142 WRGLRDEELSKES IPGCVFVHMSGFIGGN TYDGALAMARA+L+ Sbjct: 216 WRGLRDEELSKESGIPGCVFVHMSGFIGGNRTYDGALAMARAALR 260 >ref|XP_004143846.1| PREDICTED: UPF0160 protein-like [Cucumis sativus] gi|449509379|ref|XP_004163571.1| PREDICTED: UPF0160 protein-like [Cucumis sativus] Length = 345 Score = 89.0 bits (219), Expect = 4e-16 Identities = 41/47 (87%), Positives = 43/47 (91%) Frame = +2 Query: 2 AQWRGLRDEELSKESSIPGCVFVHMSGFIGGNATYDGALAMARASLK 142 AQWRGLRDEELSKES IPGCVFVHMSGFIGGN TYDGAL MA+ +LK Sbjct: 298 AQWRGLRDEELSKESGIPGCVFVHMSGFIGGNQTYDGALTMAKNALK 344 >gb|AFK48059.1| unknown [Lotus japonicus] Length = 204 Score = 87.4 bits (215), Expect = 1e-15 Identities = 39/47 (82%), Positives = 45/47 (95%) Frame = +2 Query: 2 AQWRGLRDEELSKESSIPGCVFVHMSGFIGGNATYDGALAMARASLK 142 +QWRGLRD++LSKES IPGCVFVHMSGFIGGN ++DGALAMARA+LK Sbjct: 157 SQWRGLRDDDLSKESGIPGCVFVHMSGFIGGNQSFDGALAMARAALK 203 >ref|XP_002518897.1| Protein MYG1, putative [Ricinus communis] gi|223541884|gb|EEF43430.1| Protein MYG1, putative [Ricinus communis] Length = 373 Score = 86.3 bits (212), Expect = 2e-15 Identities = 39/47 (82%), Positives = 44/47 (93%) Frame = +2 Query: 2 AQWRGLRDEELSKESSIPGCVFVHMSGFIGGNATYDGALAMARASLK 142 AQWRGLRD+ELS+ES IP CVFVHMSGFIGGN +Y+GALAMARA+LK Sbjct: 326 AQWRGLRDDELSRESGIPACVFVHMSGFIGGNKSYEGALAMARAALK 372 >ref|NP_001241305.1| uncharacterized protein LOC100800706 [Glycine max] gi|255636959|gb|ACU18812.1| unknown [Glycine max] Length = 369 Score = 85.1 bits (209), Expect = 5e-15 Identities = 38/47 (80%), Positives = 44/47 (93%) Frame = +2 Query: 2 AQWRGLRDEELSKESSIPGCVFVHMSGFIGGNATYDGALAMARASLK 142 +QWRGLRDEELSK+S IPGCVFVH+SGFIGGN +DGALAMA+A+LK Sbjct: 322 SQWRGLRDEELSKKSGIPGCVFVHISGFIGGNQNFDGALAMAKAALK 368