BLASTX nr result
ID: Coptis21_contig00012213
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis21_contig00012213 (423 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004149936.1| PREDICTED: indole-3-acetic acid-amido synthe... 84 2e-14 ref|XP_002533739.1| Indole-3-acetic acid-amido synthetase GH3.6,... 84 2e-14 ref|XP_002319260.1| GH3 family protein [Populus trichocarpa] gi|... 84 2e-14 ref|NP_200262.1| indole-3-acetic acid-amido synthetase GH3.6 [Ar... 83 2e-14 ref|XP_002866046.1| hypothetical protein ARALYDRAFT_918581 [Arab... 83 3e-14 >ref|XP_004149936.1| PREDICTED: indole-3-acetic acid-amido synthetase GH3.6-like [Cucumis sativus] gi|449516764|ref|XP_004165416.1| PREDICTED: indole-3-acetic acid-amido synthetase GH3.6-like [Cucumis sativus] Length = 604 Score = 83.6 bits (205), Expect = 2e-14 Identities = 35/39 (89%), Positives = 37/39 (94%) Frame = +3 Query: 3 YKTPRCVKFEPIVELLNSKVVTSYFSPKCPKWHPGHKQW 119 YKTPRCVKF+PIVELLNS+VV SYFSPKCPKW PGHKQW Sbjct: 562 YKTPRCVKFQPIVELLNSRVVGSYFSPKCPKWVPGHKQW 600 >ref|XP_002533739.1| Indole-3-acetic acid-amido synthetase GH3.6, putative [Ricinus communis] gi|223526345|gb|EEF28642.1| Indole-3-acetic acid-amido synthetase GH3.6, putative [Ricinus communis] Length = 612 Score = 83.6 bits (205), Expect = 2e-14 Identities = 35/39 (89%), Positives = 37/39 (94%) Frame = +3 Query: 3 YKTPRCVKFEPIVELLNSKVVTSYFSPKCPKWHPGHKQW 119 YKTPRCVKF PIVELLNS+VV+SYFSPKCPKW PGHKQW Sbjct: 570 YKTPRCVKFAPIVELLNSRVVSSYFSPKCPKWVPGHKQW 608 >ref|XP_002319260.1| GH3 family protein [Populus trichocarpa] gi|222857636|gb|EEE95183.1| GH3 family protein [Populus trichocarpa] Length = 611 Score = 83.6 bits (205), Expect = 2e-14 Identities = 35/39 (89%), Positives = 36/39 (92%) Frame = +3 Query: 3 YKTPRCVKFEPIVELLNSKVVTSYFSPKCPKWHPGHKQW 119 YKTPRCVKF PIVELLNS+VVT YFSPKCPKW PGHKQW Sbjct: 570 YKTPRCVKFAPIVELLNSRVVTCYFSPKCPKWAPGHKQW 608 >ref|NP_200262.1| indole-3-acetic acid-amido synthetase GH3.6 [Arabidopsis thaliana] gi|62900334|sp|Q9LSQ4.1|GH36_ARATH RecName: Full=Indole-3-acetic acid-amido synthetase GH3.6; AltName: Full=Auxin-responsive GH3-like protein 6; Short=AtGH3-6; AltName: Full=Protein DWARF IN LIGHT 1; Short=DFL-1 gi|8885594|dbj|BAA97524.1| auxin-responsive-like protein [Arabidopsis thaliana] gi|11041726|dbj|BAB17304.1| auxin-responsive GH3 homologue [Arabidopsis thaliana] gi|59958336|gb|AAX12878.1| At5g54510 [Arabidopsis thaliana] gi|209414530|gb|ACI46505.1| At5g54510 [Arabidopsis thaliana] gi|332009121|gb|AED96504.1| indole-3-acetic acid-amido synthetase GH3.6 [Arabidopsis thaliana] Length = 612 Score = 83.2 bits (204), Expect = 2e-14 Identities = 34/39 (87%), Positives = 36/39 (92%) Frame = +3 Query: 3 YKTPRCVKFEPIVELLNSKVVTSYFSPKCPKWHPGHKQW 119 YKTPRCVKF PI+ELLNS+VV SYFSPKCPKW PGHKQW Sbjct: 571 YKTPRCVKFAPIIELLNSRVVDSYFSPKCPKWSPGHKQW 609 >ref|XP_002866046.1| hypothetical protein ARALYDRAFT_918581 [Arabidopsis lyrata subsp. lyrata] gi|297311881|gb|EFH42305.1| hypothetical protein ARALYDRAFT_918581 [Arabidopsis lyrata subsp. lyrata] Length = 612 Score = 82.8 bits (203), Expect = 3e-14 Identities = 34/39 (87%), Positives = 36/39 (92%) Frame = +3 Query: 3 YKTPRCVKFEPIVELLNSKVVTSYFSPKCPKWHPGHKQW 119 YKTPRCVKF PI+ELLNS+VV SYFSPKCPKW PGHKQW Sbjct: 571 YKTPRCVKFAPIIELLNSRVVDSYFSPKCPKWAPGHKQW 609