BLASTX nr result
ID: Coptis21_contig00012058
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis21_contig00012058 (753 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|BAJ95356.1| predicted protein [Hordeum vulgare subsp. vulgare] 77 4e-12 ref|XP_003525096.1| PREDICTED: ribonucleoside-diphosphate reduct... 75 2e-11 gb|AFW85656.1| hypothetical protein ZEAMMB73_966032 [Zea mays] 75 2e-11 emb|CAA71816.1| ribonucleotide reductase [Nicotiana tabacum] 75 2e-11 emb|CAA71815.1| ribonucleotide reductase [Nicotiana tabacum] 75 2e-11 >dbj|BAJ95356.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 812 Score = 77.0 bits (188), Expect = 4e-12 Identities = 34/40 (85%), Positives = 37/40 (92%) Frame = -3 Query: 121 QAQHLNKDIFETIYYHALKVSSELAAKEGPYETYQGCPVS 2 +AQ LNKDIFETIYYHALK S+E+AAKEGPYETY GCPVS Sbjct: 542 EAQQLNKDIFETIYYHALKASAEIAAKEGPYETYDGCPVS 581 >ref|XP_003525096.1| PREDICTED: ribonucleoside-diphosphate reductase large subunit [Glycine max] gi|27261142|gb|AAN87547.1|AF118784_1 ribonucleotide reductase large subunit A [Glycine max] Length = 809 Score = 74.7 bits (182), Expect = 2e-11 Identities = 34/40 (85%), Positives = 36/40 (90%) Frame = -3 Query: 121 QAQHLNKDIFETIYYHALKVSSELAAKEGPYETYQGCPVS 2 +AQ LNKDIFETIYYHALK SSELAAKEGPYETY G P+S Sbjct: 542 EAQQLNKDIFETIYYHALKTSSELAAKEGPYETYSGSPIS 581 >gb|AFW85656.1| hypothetical protein ZEAMMB73_966032 [Zea mays] Length = 815 Score = 74.7 bits (182), Expect = 2e-11 Identities = 34/40 (85%), Positives = 37/40 (92%) Frame = -3 Query: 121 QAQHLNKDIFETIYYHALKVSSELAAKEGPYETYQGCPVS 2 +AQ LNKDIFETIYYHALK S+ELAAKEGPYETY+G PVS Sbjct: 542 EAQQLNKDIFETIYYHALKASAELAAKEGPYETYEGSPVS 581 >emb|CAA71816.1| ribonucleotide reductase [Nicotiana tabacum] Length = 808 Score = 74.7 bits (182), Expect = 2e-11 Identities = 35/40 (87%), Positives = 36/40 (90%) Frame = -3 Query: 121 QAQHLNKDIFETIYYHALKVSSELAAKEGPYETYQGCPVS 2 +AQ LNKDIFETIYYHALK SSELAAKEGPYETY G PVS Sbjct: 542 EAQQLNKDIFETIYYHALKASSELAAKEGPYETYAGSPVS 581 >emb|CAA71815.1| ribonucleotide reductase [Nicotiana tabacum] Length = 808 Score = 74.7 bits (182), Expect = 2e-11 Identities = 35/40 (87%), Positives = 36/40 (90%) Frame = -3 Query: 121 QAQHLNKDIFETIYYHALKVSSELAAKEGPYETYQGCPVS 2 +AQ LNKDIFETIYYHALK SSELAAKEGPYETY G PVS Sbjct: 542 EAQQLNKDIFETIYYHALKASSELAAKEGPYETYAGSPVS 581