BLASTX nr result
ID: Coptis21_contig00011918
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis21_contig00011918 (571 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AFW75942.1| auxin-independent growth promoter-like protein [Z... 44 3e-07 ref|XP_003601898.1| Auxin-independent growth protein [Medicago t... 49 3e-07 ref|NP_001152550.1| auxin-independent growth promoter-like prote... 44 3e-07 gb|ACF86391.1| unknown [Zea mays] gi|219886473|gb|ACL53611.1| un... 44 3e-07 ref|XP_004135279.1| PREDICTED: DUF246 domain-containing protein ... 48 4e-07 >gb|AFW75942.1| auxin-independent growth promoter-like protein [Zea mays] Length = 958 Score = 44.3 bits (103), Expect(2) = 3e-07 Identities = 19/31 (61%), Positives = 23/31 (74%) Frame = +2 Query: 263 VEDVIFTRQTRTGFRKEAIPNYDLPDNPLTP 355 VEDV+ T QTRTG + P+YDL +NPLTP Sbjct: 923 VEDVVITHQTRTGLPEPTFPHYDLWENPLTP 953 Score = 35.4 bits (80), Expect(2) = 3e-07 Identities = 15/30 (50%), Positives = 20/30 (66%) Frame = +3 Query: 168 GRNRILSLSKTIKSCTEFFGDPYMGWAKFV 257 GR+R+ S+ ++FFGDPYM WA FV Sbjct: 894 GRHRLKSIKPDKGLMSKFFGDPYMPWATFV 923 >ref|XP_003601898.1| Auxin-independent growth protein [Medicago truncatula] gi|355490946|gb|AES72149.1| Auxin-independent growth protein [Medicago truncatula] Length = 662 Score = 48.5 bits (114), Expect(2) = 3e-07 Identities = 22/31 (70%), Positives = 24/31 (77%) Frame = +2 Query: 263 VEDVIFTRQTRTGFRKEAIPNYDLPDNPLTP 355 VEDVI T QTRTG +E PNYDL +NPLTP Sbjct: 627 VEDVIVTHQTRTGLPEETFPNYDLWENPLTP 657 Score = 31.2 bits (69), Expect(2) = 3e-07 Identities = 13/28 (46%), Positives = 18/28 (64%) Frame = +3 Query: 174 NRILSLSKTIKSCTEFFGDPYMGWAKFV 257 +R+ S+ ++ FGDPYMGWA FV Sbjct: 600 HRLKSIKPDKGLMSKSFGDPYMGWAPFV 627 >ref|NP_001152550.1| auxin-independent growth promoter-like protein [Zea mays] gi|195657411|gb|ACG48173.1| auxin-independent growth promoter-like protein [Zea mays] Length = 555 Score = 44.3 bits (103), Expect(2) = 3e-07 Identities = 19/31 (61%), Positives = 23/31 (74%) Frame = +2 Query: 263 VEDVIFTRQTRTGFRKEAIPNYDLPDNPLTP 355 VEDV+ T QTRTG + P+YDL +NPLTP Sbjct: 520 VEDVVITHQTRTGLPEPTFPHYDLWENPLTP 550 Score = 35.4 bits (80), Expect(2) = 3e-07 Identities = 15/30 (50%), Positives = 20/30 (66%) Frame = +3 Query: 168 GRNRILSLSKTIKSCTEFFGDPYMGWAKFV 257 GR+R+ S+ ++FFGDPYM WA FV Sbjct: 491 GRHRLKSIKPDKGLMSKFFGDPYMPWATFV 520 >gb|ACF86391.1| unknown [Zea mays] gi|219886473|gb|ACL53611.1| unknown [Zea mays] Length = 555 Score = 44.3 bits (103), Expect(2) = 3e-07 Identities = 19/31 (61%), Positives = 23/31 (74%) Frame = +2 Query: 263 VEDVIFTRQTRTGFRKEAIPNYDLPDNPLTP 355 VEDV+ T QTRTG + P+YDL +NPLTP Sbjct: 520 VEDVVITHQTRTGLPEPTFPHYDLWENPLTP 550 Score = 35.4 bits (80), Expect(2) = 3e-07 Identities = 15/30 (50%), Positives = 20/30 (66%) Frame = +3 Query: 168 GRNRILSLSKTIKSCTEFFGDPYMGWAKFV 257 GR+R+ S+ ++FFGDPYM WA FV Sbjct: 491 GRHRLKSIKPDKGLMSKFFGDPYMPWATFV 520 >ref|XP_004135279.1| PREDICTED: DUF246 domain-containing protein At1g04910-like [Cucumis sativus] gi|449520691|ref|XP_004167367.1| PREDICTED: DUF246 domain-containing protein At1g04910-like [Cucumis sativus] Length = 552 Score = 48.1 bits (113), Expect(2) = 4e-07 Identities = 21/31 (67%), Positives = 24/31 (77%) Frame = +2 Query: 263 VEDVIFTRQTRTGFRKEAIPNYDLPDNPLTP 355 VEDV+ T QTRTG +E PNYDL +NPLTP Sbjct: 517 VEDVVVTHQTRTGLPEETFPNYDLWENPLTP 547 Score = 31.2 bits (69), Expect(2) = 4e-07 Identities = 13/28 (46%), Positives = 18/28 (64%) Frame = +3 Query: 174 NRILSLSKTIKSCTEFFGDPYMGWAKFV 257 +R+ S+ ++ FGDPYMGWA FV Sbjct: 490 HRLKSIKPDKGLMSKSFGDPYMGWAPFV 517