BLASTX nr result
ID: Coptis21_contig00011752
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis21_contig00011752 (297 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003616661.1| Clathrin heavy chain [Medicago truncatula] g... 62 6e-08 sp|Q2QYW2.1|CLH2_ORYSJ RecName: Full=Clathrin heavy chain 2 gi|7... 61 8e-08 ref|XP_002276855.1| PREDICTED: clathrin heavy chain 2 [Vitis vin... 61 8e-08 gb|EEC68683.1| hypothetical protein OsI_37138 [Oryza sativa Indi... 61 8e-08 gb|EAZ19365.1| hypothetical protein OsJ_34919 [Oryza sativa Japo... 61 8e-08 >ref|XP_003616661.1| Clathrin heavy chain [Medicago truncatula] gi|355517996|gb|AES99619.1| Clathrin heavy chain [Medicago truncatula] Length = 1706 Score = 61.6 bits (148), Expect = 6e-08 Identities = 30/33 (90%), Positives = 31/33 (93%) Frame = -1 Query: 297 FSQTKYKEAAELAAESPQGLLRTPDTVAMFQVV 199 FSQTKYKEAAELAAESPQG+LRTPDTVA FQ V Sbjct: 385 FSQTKYKEAAELAAESPQGILRTPDTVAKFQSV 417 >sp|Q2QYW2.1|CLH2_ORYSJ RecName: Full=Clathrin heavy chain 2 gi|77552802|gb|ABA95598.1| Clathrin heavy chain, putative, expressed [Oryza sativa Japonica Group] Length = 1708 Score = 61.2 bits (147), Expect = 8e-08 Identities = 30/33 (90%), Positives = 31/33 (93%) Frame = -1 Query: 297 FSQTKYKEAAELAAESPQGLLRTPDTVAMFQVV 199 F+QTKYKEAAELAAESPQGLLRTPDTVA FQ V Sbjct: 385 FAQTKYKEAAELAAESPQGLLRTPDTVAKFQSV 417 >ref|XP_002276855.1| PREDICTED: clathrin heavy chain 2 [Vitis vinifera] gi|297745873|emb|CBI15929.3| unnamed protein product [Vitis vinifera] Length = 1705 Score = 61.2 bits (147), Expect = 8e-08 Identities = 30/33 (90%), Positives = 31/33 (93%) Frame = -1 Query: 297 FSQTKYKEAAELAAESPQGLLRTPDTVAMFQVV 199 F+QTKYKEAAELAAESPQGLLRTPDTVA FQ V Sbjct: 385 FAQTKYKEAAELAAESPQGLLRTPDTVAKFQSV 417 >gb|EEC68683.1| hypothetical protein OsI_37138 [Oryza sativa Indica Group] Length = 1497 Score = 61.2 bits (147), Expect = 8e-08 Identities = 30/33 (90%), Positives = 31/33 (93%) Frame = -1 Query: 297 FSQTKYKEAAELAAESPQGLLRTPDTVAMFQVV 199 F+QTKYKEAAELAAESPQGLLRTPDTVA FQ V Sbjct: 385 FAQTKYKEAAELAAESPQGLLRTPDTVAKFQSV 417 >gb|EAZ19365.1| hypothetical protein OsJ_34919 [Oryza sativa Japonica Group] Length = 1708 Score = 61.2 bits (147), Expect = 8e-08 Identities = 30/33 (90%), Positives = 31/33 (93%) Frame = -1 Query: 297 FSQTKYKEAAELAAESPQGLLRTPDTVAMFQVV 199 F+QTKYKEAAELAAESPQGLLRTPDTVA FQ V Sbjct: 385 FAQTKYKEAAELAAESPQGLLRTPDTVAKFQSV 417