BLASTX nr result
ID: Coptis21_contig00011522
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis21_contig00011522 (207 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002282630.1| PREDICTED: set1/Ash2 histone methyltransfera... 53 8e-06 >ref|XP_002282630.1| PREDICTED: set1/Ash2 histone methyltransferase complex subunit ASH2 [Vitis vinifera] gi|297746293|emb|CBI16349.3| unnamed protein product [Vitis vinifera] Length = 389 Score = 52.8 bits (125), Expect(2) = 8e-06 Identities = 22/35 (62%), Positives = 28/35 (80%) Frame = +2 Query: 2 GYMEGDVIGCYIRLPDGDLYSPKVPDMGRYKGQKF 106 GY+EGDVIG YI LPDG +Y+PK P + YKGQ++ Sbjct: 252 GYVEGDVIGFYINLPDGAMYAPKPPHLVWYKGQRY 286 Score = 21.6 bits (44), Expect(2) = 8e-06 Identities = 8/24 (33%), Positives = 13/24 (54%) Frame = +3 Query: 93 RGKSFALFANQNEDSSKVVPGMSL 164 +G+ + + ED KVVPG + Sbjct: 282 KGQRYVCATDTKEDPPKVVPGSEI 305