BLASTX nr result
ID: Coptis21_contig00010679
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis21_contig00010679 (1336 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002521470.1| RNA binding protein, putative [Ricinus commu... 61 7e-07 >ref|XP_002521470.1| RNA binding protein, putative [Ricinus communis] gi|223539369|gb|EEF40960.1| RNA binding protein, putative [Ricinus communis] Length = 2256 Score = 60.8 bits (146), Expect = 7e-07 Identities = 26/40 (65%), Positives = 35/40 (87%) Frame = -2 Query: 1335 LKLKGGPTVGVYLEYATMDNGTANIHKSSGRLSRISPGNT 1216 L +KGGPT+GVY+EYA++D+G A + +SSG+LS ISPGNT Sbjct: 1164 LTVKGGPTIGVYVEYASLDDGIATVDRSSGQLSGISPGNT 1203