BLASTX nr result
ID: Coptis21_contig00010522
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis21_contig00010522 (827 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAE02508.1| P0076O17.6 [Oryza sativa Japonica Group] gi|3834... 59 1e-06 emb|CCD74546.1| F-box family protein [Arabidopsis halleri subsp.... 59 1e-06 ref|XP_002510330.1| ubiquitin-protein ligase, putative [Ricinus ... 57 4e-06 gb|EEC84521.1| hypothetical protein OsI_31233 [Oryza sativa Indi... 57 5e-06 ref|NP_200448.1| FBD-associated F-box protein [Arabidopsis thali... 57 7e-06 >emb|CAE02508.1| P0076O17.6 [Oryza sativa Japonica Group] gi|38346575|emb|CAE04222.2| OSJNBa0064D20.6 [Oryza sativa Japonica Group] Length = 291 Score = 58.9 bits (141), Expect = 1e-06 Identities = 26/52 (50%), Positives = 41/52 (78%) Frame = -1 Query: 686 RIGELPVDILYFILSLLTVKEAVRTSILSRRWRYLWKTTLASSPKLELDVVD 531 R+GELP ++L ILS LT ++AV+TS+LSRRWR+LW++T P+ ++D+ + Sbjct: 38 RLGELPDELLLSILSCLTTRQAVQTSVLSRRWRHLWRST----PRFDVDLAE 85 >emb|CCD74546.1| F-box family protein [Arabidopsis halleri subsp. halleri] Length = 530 Score = 58.9 bits (141), Expect = 1e-06 Identities = 30/69 (43%), Positives = 43/69 (62%) Frame = -1 Query: 713 IAFSTISMDRIGELPVDILYFILSLLTVKEAVRTSILSRRWRYLWKTTLASSPKLELDVV 534 I+F ++ DRI ELP +L ILS L K++V+TS+LS+RW +LW L + V+ Sbjct: 85 ISFLAMNCDRISELPDSLLTQILSYLPTKDSVKTSLLSKRWEFLW---------LRVPVL 135 Query: 533 DRRCKDFPD 507 D + DFPD Sbjct: 136 DLKVSDFPD 144 >ref|XP_002510330.1| ubiquitin-protein ligase, putative [Ricinus communis] gi|223551031|gb|EEF52517.1| ubiquitin-protein ligase, putative [Ricinus communis] Length = 426 Score = 57.4 bits (137), Expect = 4e-06 Identities = 42/141 (29%), Positives = 65/141 (46%), Gaps = 2/141 (1%) Frame = -1 Query: 692 MDRIGELPVDILYFILSLLTVKEAVRTSILSRRWRYLWKTTLASSPKLELDVVDRRCKDF 513 +DRI LP +L ILS L++++AVRTS LSR+WRY W A P L D Sbjct: 15 LDRISSLPGHVLDQILSQLSIRDAVRTSALSRKWRYKW----AKIPHLVFD--------- 61 Query: 512 PDNMIGYCLAGPFYSCVPVPSRRVGFKRHDFVGFVLHVLYLDHFSVKNSSRTRIYLENDF 333 CV +PS+ + V + HVL L + ++ + D Sbjct: 62 -------------NKCVSIPSQDQTLIKDKLVNIIDHVLLLHNGPIQKFKLS----HRDL 104 Query: 332 LHFT--DQWMMEMAVSQMKDF 276 L + D+W++ ++ S +K+F Sbjct: 105 LGVSDIDRWILHLSRSSIKEF 125 >gb|EEC84521.1| hypothetical protein OsI_31233 [Oryza sativa Indica Group] Length = 388 Score = 57.0 bits (136), Expect = 5e-06 Identities = 31/76 (40%), Positives = 42/76 (55%) Frame = -1 Query: 689 DRIGELPVDILYFILSLLTVKEAVRTSILSRRWRYLWKTTLASSPKLELDVVDRRCKDFP 510 D IG LP +L+ +LS L KE VRT +L+RRWR+LWK S P L + D F Sbjct: 17 DHIGALPDALLHHVLSFLQSKEVVRTCVLARRWRHLWK----SVPVLRVTGADEAIHKFM 72 Query: 509 DNMIGYCLAGPFYSCV 462 D+++ P +CV Sbjct: 73 DHLLLLRERSPLEACV 88 >ref|NP_200448.1| FBD-associated F-box protein [Arabidopsis thaliana] gi|42573692|ref|NP_974942.1| FBD-associated F-box protein [Arabidopsis thaliana] gi|75262703|sp|Q9FM94.1|FBD21_ARATH RecName: Full=FBD-associated F-box protein At5g56370 gi|10177836|dbj|BAB11265.1| unnamed protein product [Arabidopsis thaliana] gi|46518439|gb|AAS99701.1| At5g56370 [Arabidopsis thaliana] gi|51970526|dbj|BAD43955.1| unknown protein [Arabidopsis thaliana] gi|332009373|gb|AED96756.1| FBD-associated F-box protein [Arabidopsis thaliana] gi|332009374|gb|AED96757.1| FBD-associated F-box protein [Arabidopsis thaliana] Length = 421 Score = 56.6 bits (135), Expect = 7e-06 Identities = 28/55 (50%), Positives = 36/55 (65%) Frame = -1 Query: 692 MDRIGELPVDILYFILSLLTVKEAVRTSILSRRWRYLWKTTLASSPKLELDVVDR 528 MD I LP D L ILSLL K+ + TS+LS+RWRYLWK PKL+ ++D+ Sbjct: 1 MDSISLLPDDFLLRILSLLPTKDVLNTSVLSKRWRYLWKLV----PKLQYSLIDK 51