BLASTX nr result
ID: Coptis21_contig00010291
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis21_contig00010291 (311 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002523830.1| 40S ribosomal protein S14, putative [Ricinus... 50 1e-09 ref|XP_003579705.1| PREDICTED: 40S ribosomal protein S14-like [B... 50 2e-09 ref|XP_003563419.1| PREDICTED: 40S ribosomal protein S14-like [B... 50 2e-09 ref|XP_001634075.1| predicted protein [Nematostella vectensis] g... 49 2e-09 gb|ABR16248.1| unknown [Picea sitchensis] gi|224286786|gb|ACN410... 48 3e-09 >ref|XP_002523830.1| 40S ribosomal protein S14, putative [Ricinus communis] gi|223536918|gb|EEF38556.1| 40S ribosomal protein S14, putative [Ricinus communis] Length = 150 Score = 50.1 bits (118), Expect(2) = 1e-09 Identities = 23/27 (85%), Positives = 25/27 (92%) Frame = -2 Query: 307 ITARCKDLGITALHIKLRAT*GNKTKT 227 +T RCK+LGITALHIKLRAT GNKTKT Sbjct: 80 VTQRCKELGITALHIKLRATGGNKTKT 106 Score = 37.4 bits (85), Expect(2) = 1e-09 Identities = 24/48 (50%), Positives = 28/48 (58%) Frame = -1 Query: 233 KDPGPSAQFALRVLARSGLKILVALRMLFLFYQ*SSMHRKGSRMGRKL 90 K PGP AQ ALR LARSG+KI + + S RKG R GR+L Sbjct: 105 KTPGPGAQSALRALARSGMKIGRIEDVTPI--PTDSTRRKGGRRGRRL 150 >ref|XP_003579705.1| PREDICTED: 40S ribosomal protein S14-like [Brachypodium distachyon] Length = 151 Score = 50.1 bits (118), Expect(2) = 2e-09 Identities = 23/27 (85%), Positives = 25/27 (92%) Frame = -2 Query: 307 ITARCKDLGITALHIKLRAT*GNKTKT 227 + ARCK+LGITALHIKLRAT GNKTKT Sbjct: 81 VAARCKELGITALHIKLRATGGNKTKT 107 Score = 37.0 bits (84), Expect(2) = 2e-09 Identities = 24/48 (50%), Positives = 28/48 (58%) Frame = -1 Query: 233 KDPGPSAQFALRVLARSGLKILVALRMLFLFYQ*SSMHRKGSRMGRKL 90 K PGP AQ ALR LARSG+KI + + S RKG R GR+L Sbjct: 106 KTPGPGAQSALRALARSGMKIGRIEDVTPV--PTDSTRRKGGRRGRRL 151 >ref|XP_003563419.1| PREDICTED: 40S ribosomal protein S14-like [Brachypodium distachyon] Length = 150 Score = 50.1 bits (118), Expect(2) = 2e-09 Identities = 23/27 (85%), Positives = 25/27 (92%) Frame = -2 Query: 307 ITARCKDLGITALHIKLRAT*GNKTKT 227 + ARCK+LGITALHIKLRAT GNKTKT Sbjct: 80 VAARCKELGITALHIKLRATGGNKTKT 106 Score = 37.0 bits (84), Expect(2) = 2e-09 Identities = 24/48 (50%), Positives = 28/48 (58%) Frame = -1 Query: 233 KDPGPSAQFALRVLARSGLKILVALRMLFLFYQ*SSMHRKGSRMGRKL 90 K PGP AQ ALR LARSG+KI + + S RKG R GR+L Sbjct: 105 KTPGPGAQAALRALARSGMKIGRIEDVTPV--PTDSTRRKGGRRGRRL 150 >ref|XP_001634075.1| predicted protein [Nematostella vectensis] gi|156221154|gb|EDO42012.1| predicted protein [Nematostella vectensis] Length = 153 Score = 49.3 bits (116), Expect(2) = 2e-09 Identities = 22/27 (81%), Positives = 25/27 (92%) Frame = -2 Query: 307 ITARCKDLGITALHIKLRAT*GNKTKT 227 + ARCK++GITALHIKLRAT GNKTKT Sbjct: 83 VAARCKEIGITALHIKLRATGGNKTKT 109 Score = 37.4 bits (85), Expect(2) = 2e-09 Identities = 24/48 (50%), Positives = 28/48 (58%) Frame = -1 Query: 233 KDPGPSAQFALRVLARSGLKILVALRMLFLFYQ*SSMHRKGSRMGRKL 90 K PGP AQ ALR LARSG+KI + + S RKG R GR+L Sbjct: 108 KTPGPGAQSALRALARSGMKIGRIEDVTPI--PSDSTRRKGGRRGRRL 153 >gb|ABR16248.1| unknown [Picea sitchensis] gi|224286786|gb|ACN41096.1| unknown [Picea sitchensis] Length = 151 Score = 48.1 bits (113), Expect(2) = 3e-09 Identities = 22/27 (81%), Positives = 24/27 (88%) Frame = -2 Query: 307 ITARCKDLGITALHIKLRAT*GNKTKT 227 + RCK+LGITALHIKLRAT GNKTKT Sbjct: 81 VAQRCKELGITALHIKLRATGGNKTKT 107 Score = 38.1 bits (87), Expect(2) = 3e-09 Identities = 25/48 (52%), Positives = 28/48 (58%) Frame = -1 Query: 233 KDPGPSAQFALRVLARSGLKILVALRMLFLFYQ*SSMHRKGSRMGRKL 90 K PGP AQ ALR LARSGLKI + + S RKG R GR+L Sbjct: 106 KTPGPGAQSALRALARSGLKIGRIEDVTPI--PTDSTRRKGGRRGRRL 151