BLASTX nr result
ID: Coptis21_contig00010286
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis21_contig00010286 (232 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002272924.1| PREDICTED: uncharacterized protein LOC100252... 102 4e-20 emb|CAN67529.1| hypothetical protein VITISV_004310 [Vitis vinifera] 102 4e-20 ref|XP_003635069.1| PREDICTED: uncharacterized protein LOC100854... 100 1e-19 ref|XP_002525796.1| transcription factor, putative [Ricinus comm... 100 2e-19 gb|ADL36672.1| COL domain class transcription factor [Malus x do... 99 3e-19 >ref|XP_002272924.1| PREDICTED: uncharacterized protein LOC100252747 [Vitis vinifera] Length = 299 Score = 102 bits (253), Expect = 4e-20 Identities = 44/63 (69%), Positives = 52/63 (82%) Frame = +1 Query: 1 SDQASLCWNCDSKIHSANFLVAKHTRSLLCHLCQFPTSWTASGPKLGSTVSMCEVCVVSN 180 SDQASLCW+CD+K+H ANFLVA+H+RSLLCH+C+ PT W ASG KLG TVS+CE CV Sbjct: 17 SDQASLCWDCDAKVHGANFLVARHSRSLLCHVCRSPTPWRASGAKLGHTVSVCERCVDGC 76 Query: 181 GNR 189 G R Sbjct: 77 GGR 79 >emb|CAN67529.1| hypothetical protein VITISV_004310 [Vitis vinifera] Length = 299 Score = 102 bits (253), Expect = 4e-20 Identities = 44/63 (69%), Positives = 52/63 (82%) Frame = +1 Query: 1 SDQASLCWNCDSKIHSANFLVAKHTRSLLCHLCQFPTSWTASGPKLGSTVSMCEVCVVSN 180 SDQASLCW+CD+K+H ANFLVA+H+RSLLCH+C+ PT W ASG KLG TVS+CE CV Sbjct: 17 SDQASLCWDCDAKVHGANFLVARHSRSLLCHVCRSPTPWRASGAKLGHTVSVCERCVDGC 76 Query: 181 GNR 189 G R Sbjct: 77 GGR 79 >ref|XP_003635069.1| PREDICTED: uncharacterized protein LOC100854750 [Vitis vinifera] Length = 188 Score = 100 bits (249), Expect = 1e-19 Identities = 42/57 (73%), Positives = 51/57 (89%) Frame = +1 Query: 1 SDQASLCWNCDSKIHSANFLVAKHTRSLLCHLCQFPTSWTASGPKLGSTVSMCEVCV 171 SDQASLC +CD+K+HSANFLVAKH+R+LLCH+CQ PT W SGPKLGST+S+C+ CV Sbjct: 17 SDQASLCCDCDAKVHSANFLVAKHSRTLLCHVCQSPTPWNGSGPKLGSTISVCQRCV 73 >ref|XP_002525796.1| transcription factor, putative [Ricinus communis] gi|223534946|gb|EEF36632.1| transcription factor, putative [Ricinus communis] Length = 268 Score = 99.8 bits (247), Expect = 2e-19 Identities = 42/56 (75%), Positives = 48/56 (85%) Frame = +1 Query: 1 SDQASLCWNCDSKIHSANFLVAKHTRSLLCHLCQFPTSWTASGPKLGSTVSMCEVC 168 SDQASLCW+CD K+HSANFLVAKH R+LLC +CQ PT W ASGPKLG TVS+C+ C Sbjct: 17 SDQASLCWSCDEKVHSANFLVAKHCRNLLCQVCQSPTPWKASGPKLGPTVSICDSC 72 >gb|ADL36672.1| COL domain class transcription factor [Malus x domestica] Length = 232 Score = 99.4 bits (246), Expect = 3e-19 Identities = 42/63 (66%), Positives = 51/63 (80%) Frame = +1 Query: 1 SDQASLCWNCDSKIHSANFLVAKHTRSLLCHLCQFPTSWTASGPKLGSTVSMCEVCVVSN 180 SDQA LCW+CD+K+H ANFLV++H+RSLLCH CQ PT W ASG KLG T S+CE CV+ + Sbjct: 17 SDQAILCWDCDAKVHGANFLVSRHSRSLLCHGCQSPTPWKASGEKLGHTFSVCESCVLPD 76 Query: 181 GNR 189 G R Sbjct: 77 GGR 79