BLASTX nr result
ID: Coptis21_contig00010091
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis21_contig00010091 (365 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002864012.1| hypothetical protein ARALYDRAFT_495031 [Arab... 44 3e-07 >ref|XP_002864012.1| hypothetical protein ARALYDRAFT_495031 [Arabidopsis lyrata subsp. lyrata] gi|297309847|gb|EFH40271.1| hypothetical protein ARALYDRAFT_495031 [Arabidopsis lyrata subsp. lyrata] Length = 228 Score = 44.3 bits (103), Expect(2) = 3e-07 Identities = 23/43 (53%), Positives = 30/43 (69%) Frame = +3 Query: 12 MEAEVKVSENRIMKYSERDELRLKRKTLQSVLDQCQRALELIN 140 M+ + K RI K D +R+KRKTLQ++LD CQRALEL+N Sbjct: 1 MDIDSKNKGKRIYK----DNIRVKRKTLQALLDDCQRALELLN 39 Score = 35.0 bits (79), Expect(2) = 3e-07 Identities = 19/34 (55%), Positives = 23/34 (67%) Frame = +2 Query: 260 QEAELDDGSADSETTELCDILKSRVESPDFLEKL 361 QE E + G D E EL D++KSRVE DFLEK+ Sbjct: 59 QEEESNRG--DPEADELYDLIKSRVECDDFLEKI 90