BLASTX nr result
ID: Coptis21_contig00009712
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis21_contig00009712 (656 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003632370.1| PREDICTED: cyclin-dependent kinase inhibitor... 80 3e-13 ref|XP_002464499.1| hypothetical protein SORBIDRAFT_01g019550 [S... 74 2e-11 ref|NP_001168443.1| uncharacterized protein LOC100382215 [Zea ma... 71 2e-10 ref|NP_199693.1| cyclin-dependent kinase inhibitor 3 [Arabidopsi... 71 2e-10 ref|NP_001190495.1| cyclin-dependent kinase inhibitor 3 [Arabido... 71 2e-10 >ref|XP_003632370.1| PREDICTED: cyclin-dependent kinase inhibitor 3-like [Vitis vinifera] gi|297744341|emb|CBI37311.3| unnamed protein product [Vitis vinifera] Length = 218 Score = 80.1 bits (196), Expect = 3e-13 Identities = 44/68 (64%), Positives = 50/68 (73%) Frame = +1 Query: 205 MGKYMRKAKITGEIAVMETTTTSLVSGGVRTRAKTLALQRLQKTTXXXXXXXXXCYLQLR 384 MGKYM+KAKITG++ VME ++ S GVRTRAKTLALQRLQKTT YL+LR Sbjct: 1 MGKYMKKAKITGDVTVMEVSS----SLGVRTRAKTLALQRLQKTTHQEGPKPDTSYLELR 56 Query: 385 SRRLEKKP 408 SRRLEK P Sbjct: 57 SRRLEKPP 64 >ref|XP_002464499.1| hypothetical protein SORBIDRAFT_01g019550 [Sorghum bicolor] gi|241918353|gb|EER91497.1| hypothetical protein SORBIDRAFT_01g019550 [Sorghum bicolor] Length = 191 Score = 74.3 bits (181), Expect = 2e-11 Identities = 39/70 (55%), Positives = 49/70 (70%) Frame = +1 Query: 205 MGKYMRKAKITGEIAVMETTTTSLVSGGVRTRAKTLALQRLQKTTXXXXXXXXXCYLQLR 384 MGKYMRK K++GE+A+M+ ++ L GVRTRA+ LALQRLQK YL+LR Sbjct: 1 MGKYMRKVKVSGEVAIMDVSSAPL---GVRTRARALALQRLQKQQAQGEEGAGGEYLELR 57 Query: 385 SRRLEKKPPS 414 SRRLEK PP+ Sbjct: 58 SRRLEKLPPT 67 >ref|NP_001168443.1| uncharacterized protein LOC100382215 [Zea mays] gi|223948339|gb|ACN28253.1| unknown [Zea mays] gi|413934057|gb|AFW68608.1| hypothetical protein ZEAMMB73_775583 [Zea mays] Length = 192 Score = 71.2 bits (173), Expect = 2e-10 Identities = 38/73 (52%), Positives = 47/73 (64%) Frame = +1 Query: 205 MGKYMRKAKITGEIAVMETTTTSLVSGGVRTRAKTLALQRLQKTTXXXXXXXXXCYLQLR 384 MGKYMRK K++ E+A+M+ L GVRTRA+ LALQRL+K YL+LR Sbjct: 1 MGKYMRKVKVSSEVAIMDVAAAPL---GVRTRARALALQRLEKQQVQQEEGCGGEYLELR 57 Query: 385 SRRLEKKPPSLLS 423 SRRLEK PP + S Sbjct: 58 SRRLEKLPPQVAS 70 >ref|NP_199693.1| cyclin-dependent kinase inhibitor 3 [Arabidopsis thaliana] gi|75262601|sp|Q9FKB5.1|KRP3_ARATH RecName: Full=Cyclin-dependent kinase inhibitor 3; AltName: Full=Inhibitor/interactor of CDK protein 6; AltName: Full=KIP-related protein 3 gi|9758881|dbj|BAB09435.1| unnamed protein product [Arabidopsis thaliana] gi|14422289|emb|CAC41617.1| cyclin-dependent kinase inhibitor 3 [Arabidopsis thaliana] gi|94442511|gb|ABF19043.1| At5g48820 [Arabidopsis thaliana] gi|332008345|gb|AED95728.1| cyclin-dependent kinase inhibitor 3 [Arabidopsis thaliana] Length = 222 Score = 70.9 bits (172), Expect = 2e-10 Identities = 43/74 (58%), Positives = 52/74 (70%), Gaps = 2/74 (2%) Frame = +1 Query: 205 MGKYMRKAKITGEIAVMETTTTSLVSGGVRTR-AKTLALQRLQKT-TXXXXXXXXXCYLQ 378 MGKYM+K+KITG+I+VME + + S GVRTR AKTLAL+RL + CYLQ Sbjct: 1 MGKYMKKSKITGDISVMEVSKATAPSPGVRTRAAKTLALKRLNSSAADSALPNDSSCYLQ 60 Query: 379 LRSRRLEKKPPSLL 420 LRSRRLE KP SL+ Sbjct: 61 LRSRRLE-KPSSLI 73 >ref|NP_001190495.1| cyclin-dependent kinase inhibitor 3 [Arabidopsis thaliana] gi|332008346|gb|AED95729.1| cyclin-dependent kinase inhibitor 3 [Arabidopsis thaliana] Length = 240 Score = 70.9 bits (172), Expect = 2e-10 Identities = 43/74 (58%), Positives = 52/74 (70%), Gaps = 2/74 (2%) Frame = +1 Query: 205 MGKYMRKAKITGEIAVMETTTTSLVSGGVRTR-AKTLALQRLQKT-TXXXXXXXXXCYLQ 378 MGKYM+K+KITG+I+VME + + S GVRTR AKTLAL+RL + CYLQ Sbjct: 1 MGKYMKKSKITGDISVMEVSKATAPSPGVRTRAAKTLALKRLNSSAADSALPNDSSCYLQ 60 Query: 379 LRSRRLEKKPPSLL 420 LRSRRLE KP SL+ Sbjct: 61 LRSRRLE-KPSSLI 73