BLASTX nr result
ID: Coptis21_contig00008910
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis21_contig00008910 (664 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004170410.1| PREDICTED: LOW QUALITY PROTEIN: polyol trans... 62 1e-07 ref|XP_004148857.1| PREDICTED: polyol transporter 5-like [Cucumi... 62 1e-07 ref|XP_002519083.1| sugar transporter, putative [Ricinus communi... 61 2e-07 dbj|BAD42345.1| sorbitol transporter [Malus x domestica] 60 5e-07 dbj|BAM66295.1| sorbitol transporter, partial [Pyrus pyrifolia] 60 5e-07 >ref|XP_004170410.1| PREDICTED: LOW QUALITY PROTEIN: polyol transporter 5-like [Cucumis sativus] Length = 533 Score = 61.6 bits (148), Expect = 1e-07 Identities = 29/34 (85%), Positives = 31/34 (91%) Frame = +2 Query: 338 YSLIGSAAVGRTSDWIGRKYTIVVAAVILFVGAL 439 YSLIGSAA GRTSDWIGR+YT+VVAAVI F GAL Sbjct: 84 YSLIGSAAAGRTSDWIGRRYTMVVAAVIFFAGAL 117 >ref|XP_004148857.1| PREDICTED: polyol transporter 5-like [Cucumis sativus] Length = 533 Score = 61.6 bits (148), Expect = 1e-07 Identities = 29/34 (85%), Positives = 31/34 (91%) Frame = +2 Query: 338 YSLIGSAAVGRTSDWIGRKYTIVVAAVILFVGAL 439 YSLIGSAA GRTSDWIGR+YT+VVAAVI F GAL Sbjct: 84 YSLIGSAAAGRTSDWIGRRYTMVVAAVIFFAGAL 117 >ref|XP_002519083.1| sugar transporter, putative [Ricinus communis] gi|223541746|gb|EEF43294.1| sugar transporter, putative [Ricinus communis] Length = 539 Score = 60.8 bits (146), Expect = 2e-07 Identities = 28/34 (82%), Positives = 30/34 (88%) Frame = +2 Query: 338 YSLIGSAAVGRTSDWIGRKYTIVVAAVILFVGAL 439 YSL+GSAA GRTSDWIGR+YTIVVA I FVGAL Sbjct: 84 YSLVGSAAAGRTSDWIGRRYTIVVAGAIFFVGAL 117 >dbj|BAD42345.1| sorbitol transporter [Malus x domestica] Length = 535 Score = 59.7 bits (143), Expect = 5e-07 Identities = 27/34 (79%), Positives = 30/34 (88%) Frame = +2 Query: 338 YSLIGSAAVGRTSDWIGRKYTIVVAAVILFVGAL 439 YSLIGSAA GRTSDW+GR+YTIV+A I FVGAL Sbjct: 83 YSLIGSAAAGRTSDWVGRRYTIVLAGAIFFVGAL 116 >dbj|BAM66295.1| sorbitol transporter, partial [Pyrus pyrifolia] Length = 454 Score = 59.7 bits (143), Expect = 5e-07 Identities = 27/34 (79%), Positives = 30/34 (88%) Frame = +2 Query: 338 YSLIGSAAVGRTSDWIGRKYTIVVAAVILFVGAL 439 YSLIGSAA GRTSDW+GR+YTIV+A I FVGAL Sbjct: 34 YSLIGSAAAGRTSDWVGRRYTIVLAGAIFFVGAL 67