BLASTX nr result
ID: Coptis21_contig00008630
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis21_contig00008630 (324 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABB55293.1| hypothetical protein 10.t00044 [Asparagus officin... 99 4e-19 gb|ABD63122.1| hypothetical protein 18.t00018 [Asparagus officin... 76 2e-12 >gb|ABB55293.1| hypothetical protein 10.t00044 [Asparagus officinalis] Length = 176 Score = 99.0 bits (245), Expect = 4e-19 Identities = 42/66 (63%), Positives = 56/66 (84%) Frame = +1 Query: 1 RNLKINFKVDIPIYDGTVDANKLDNWIDRLEAYYTIYKYSNSDKIKFTTLKFSSHALTWW 180 +NLKI+FKV+I IYDG+VD +LD+WI+R+E Y+T+Y YS+ +KI FTTLK S HALTWW Sbjct: 105 QNLKIDFKVEILIYDGSVDVERLDDWIERMETYFTLYGYSSKEKIVFTTLKLSGHALTWW 164 Query: 181 KSFRKR 198 KS+ K+ Sbjct: 165 KSYCKQ 170 >gb|ABD63122.1| hypothetical protein 18.t00018 [Asparagus officinalis] Length = 189 Score = 76.3 bits (186), Expect = 2e-12 Identities = 31/58 (53%), Positives = 45/58 (77%) Frame = +1 Query: 1 RNLKINFKVDIPIYDGTVDANKLDNWIDRLEAYYTIYKYSNSDKIKFTTLKFSSHALT 174 +NLKI FKV+I +YDG+V+ + D+WI+R+E Y+ +Y YS+ +K+ F TLK S HALT Sbjct: 131 QNLKIGFKVEISVYDGSVNVERFDDWIERMETYFILYGYSSKEKLVFVTLKLSGHALT 188