BLASTX nr result
ID: Coptis21_contig00008116
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis21_contig00008116 (378 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003616487.1| Metallocarboxypeptidase inhibitor [Medicago ... 55 5e-06 >ref|XP_003616487.1| Metallocarboxypeptidase inhibitor [Medicago truncatula] gi|355517822|gb|AES99445.1| Metallocarboxypeptidase inhibitor [Medicago truncatula] Length = 448 Score = 55.5 bits (132), Expect = 5e-06 Identities = 25/30 (83%), Positives = 25/30 (83%) Frame = +1 Query: 4 CGGTLRFSGRWILTNVCVTQADILGCALGK 93 CGGTLRFSG WILTNVCVTQADIL A K Sbjct: 411 CGGTLRFSGHWILTNVCVTQADILASASSK 440