BLASTX nr result
ID: Coptis21_contig00007398
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis21_contig00007398 (354 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002263284.1| PREDICTED: uncharacterized protein At5g48480... 56 3e-06 >ref|XP_002263284.1| PREDICTED: uncharacterized protein At5g48480 [Vitis vinifera] Length = 161 Score = 56.2 bits (134), Expect = 3e-06 Identities = 25/36 (69%), Positives = 31/36 (86%) Frame = +1 Query: 244 SVSFFGLKPQVFVEAPKASDAVQFYKTVFGAEELKR 351 +V+F +KPQ+FVEAPKA+DAVQFYK FGAEE+ R Sbjct: 15 AVTFTAVKPQLFVEAPKATDAVQFYKAAFGAEEVNR 50