BLASTX nr result
ID: Coptis21_contig00007091
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis21_contig00007091 (658 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002511313.1| pentatricopeptide repeat-containing protein,... 46 1e-06 ref|XP_002277390.1| PREDICTED: pentatricopeptide repeat-containi... 41 2e-06 >ref|XP_002511313.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223550428|gb|EEF51915.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 627 Score = 45.8 bits (107), Expect(2) = 1e-06 Identities = 22/39 (56%), Positives = 28/39 (71%), Gaps = 1/39 (2%) Frame = -3 Query: 557 STKLNYETILYVLKQLEKYPHWALDFLNWSV-KNEFKPS 444 S L +ET++YVLK+L+K PH A DF NW +N FKPS Sbjct: 87 SPLLTHETVIYVLKKLDKDPHKAWDFFNWVCDRNGFKPS 125 Score = 32.0 bits (71), Expect(2) = 1e-06 Identities = 16/36 (44%), Positives = 22/36 (61%) Frame = -1 Query: 376 KPSLTVYNLVLRILGCNESMNKFRDVVNKISSQGRY 269 KPS +Y+L+LRIL +SM F + K+ QG Y Sbjct: 123 KPSSPLYSLMLRILVKKDSMKNFWITLRKMKEQGFY 158 >ref|XP_002277390.1| PREDICTED: pentatricopeptide repeat-containing protein At3g48250, chloroplastic-like [Vitis vinifera] Length = 631 Score = 40.8 bits (94), Expect(3) = 2e-06 Identities = 19/39 (48%), Positives = 28/39 (71%), Gaps = 1/39 (2%) Frame = -3 Query: 557 STKLNYETILYVLKQLEKYPHWALDFLNW-SVKNEFKPS 444 S+ L +ET++YVLK+L+K P +F NW + KN F+PS Sbjct: 89 SSVLTHETVIYVLKKLDKDPQRTWNFFNWVTEKNGFRPS 127 Score = 30.4 bits (67), Expect(3) = 2e-06 Identities = 14/34 (41%), Positives = 21/34 (61%) Frame = -1 Query: 376 KPSLTVYNLVLRILGCNESMNKFRDVVNKISSQG 275 +PS +Y+L+LR L ESM +F + K+ QG Sbjct: 125 RPSSAMYSLILRSLVHGESMKQFWVTIRKMKEQG 158 Score = 25.4 bits (54), Expect(3) = 2e-06 Identities = 12/19 (63%), Positives = 15/19 (78%) Frame = -2 Query: 654 KL*FSCTPSSIVELVMMNE 598 KL FS P+SIVELV+ N+ Sbjct: 58 KLFFSSKPNSIVELVLEND 76