BLASTX nr result
ID: Coptis21_contig00007052
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis21_contig00007052 (398 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003635207.1| PREDICTED: uncharacterized protein LOC100853... 63 2e-08 ref|XP_003635208.1| PREDICTED: uncharacterized protein LOC100853... 58 9e-07 ref|XP_003530985.1| PREDICTED: uncharacterized protein LOC100798... 55 8e-06 >ref|XP_003635207.1| PREDICTED: uncharacterized protein LOC100853563 [Vitis vinifera] Length = 60 Score = 63.2 bits (152), Expect = 2e-08 Identities = 32/46 (69%), Positives = 38/46 (82%), Gaps = 1/46 (2%) Frame = +2 Query: 41 MAGARRMMKVNGAN-TQRISGRPIPKRGQVKAGIAIGLAHSLSAIF 175 MAG RR M +NG N +QR SGRPIPKRGQVK GI +GLAHS+++IF Sbjct: 1 MAGGRRAM-INGGNFSQRFSGRPIPKRGQVKVGIVVGLAHSVASIF 45 >ref|XP_003635208.1| PREDICTED: uncharacterized protein LOC100853596 [Vitis vinifera] Length = 60 Score = 57.8 bits (138), Expect = 9e-07 Identities = 28/45 (62%), Positives = 34/45 (75%) Frame = +2 Query: 41 MAGARRMMKVNGANTQRISGRPIPKRGQVKAGIAIGLAHSLSAIF 175 MAG R M G+ +QR SGRPIPKRGQVK IA+G AHS+++IF Sbjct: 1 MAGGRGDMINGGSFSQRFSGRPIPKRGQVKVAIAVGFAHSVASIF 45 >ref|XP_003530985.1| PREDICTED: uncharacterized protein LOC100798405 [Glycine max] Length = 64 Score = 54.7 bits (130), Expect = 8e-06 Identities = 28/47 (59%), Positives = 35/47 (74%), Gaps = 2/47 (4%) Frame = +2 Query: 41 MAGARRMMKVNGANT--QRISGRPIPKRGQVKAGIAIGLAHSLSAIF 175 MAGAR +NG + +R SGRPIPKRGQVK GI +GLA+S+ +IF Sbjct: 1 MAGARASGMMNGGRSFPRRFSGRPIPKRGQVKVGIVVGLANSVVSIF 47