BLASTX nr result
ID: Coptis21_contig00007028
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis21_contig00007028 (339 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003552957.1| PREDICTED: U-box domain-containing protein 4... 94 1e-17 ref|XP_003538403.1| PREDICTED: U-box domain-containing protein 4... 92 4e-17 ref|XP_003545263.1| PREDICTED: U-box domain-containing protein 4... 90 2e-16 ref|XP_002273909.1| PREDICTED: U-box domain-containing protein 4... 89 3e-16 ref|XP_002305204.1| predicted protein [Populus trichocarpa] gi|2... 89 4e-16 >ref|XP_003552957.1| PREDICTED: U-box domain-containing protein 4-like [Glycine max] Length = 384 Score = 94.0 bits (232), Expect = 1e-17 Identities = 45/53 (84%), Positives = 50/53 (94%) Frame = -3 Query: 337 ENIVYNIVSQIDGEDPGGKAKKMLADMVQVSMEQSLRHLQQRALVCTPTDLPL 179 ENIV NI+SQIDG+D GKAKKMLA+MVQVSMEQSLRHLQQRALVCTP+DLP+ Sbjct: 321 ENIVCNIISQIDGDDQSGKAKKMLAEMVQVSMEQSLRHLQQRALVCTPSDLPI 373 >ref|XP_003538403.1| PREDICTED: U-box domain-containing protein 4-like [Glycine max] Length = 392 Score = 92.0 bits (227), Expect = 4e-17 Identities = 44/53 (83%), Positives = 50/53 (94%) Frame = -3 Query: 337 ENIVYNIVSQIDGEDPGGKAKKMLADMVQVSMEQSLRHLQQRALVCTPTDLPL 179 ENIV +I+SQIDG+D GKAKKMLA+MVQVSMEQSLRHLQQRALVCTP+DLP+ Sbjct: 329 ENIVCSIISQIDGDDQSGKAKKMLAEMVQVSMEQSLRHLQQRALVCTPSDLPI 381 >ref|XP_003545263.1| PREDICTED: U-box domain-containing protein 4-like [Glycine max] Length = 371 Score = 89.7 bits (221), Expect = 2e-16 Identities = 42/53 (79%), Positives = 50/53 (94%) Frame = -3 Query: 337 ENIVYNIVSQIDGEDPGGKAKKMLADMVQVSMEQSLRHLQQRALVCTPTDLPL 179 ENIV +I+SQIDG+D GKAKKMLA+MVQVSMEQSLRHLQQRALVCTP+++P+ Sbjct: 308 ENIVCDIISQIDGDDQSGKAKKMLAEMVQVSMEQSLRHLQQRALVCTPSEMPI 360 >ref|XP_002273909.1| PREDICTED: U-box domain-containing protein 4 [Vitis vinifera] gi|147807233|emb|CAN61950.1| hypothetical protein VITISV_002189 [Vitis vinifera] Length = 378 Score = 89.4 bits (220), Expect = 3e-16 Identities = 43/53 (81%), Positives = 48/53 (90%) Frame = -3 Query: 337 ENIVYNIVSQIDGEDPGGKAKKMLADMVQVSMEQSLRHLQQRALVCTPTDLPL 179 ENIV N++SQID ED KAKKMLA+MVQVSMEQSLRHLQQRA+VCTPTDLP+ Sbjct: 316 ENIVCNLISQIDSEDQSRKAKKMLAEMVQVSMEQSLRHLQQRAVVCTPTDLPI 368 >ref|XP_002305204.1| predicted protein [Populus trichocarpa] gi|222848168|gb|EEE85715.1| predicted protein [Populus trichocarpa] Length = 389 Score = 89.0 bits (219), Expect = 4e-16 Identities = 45/55 (81%), Positives = 50/55 (90%), Gaps = 2/55 (3%) Frame = -3 Query: 337 ENIVYNIVSQIDGEDPGGKAKKMLADMVQVSMEQSLRHLQQRALVCTPT--DLPL 179 ENIV NI+SQIDG++ GKAKKMLA+MVQVSMEQSLRHLQQRALVCTPT DLP+ Sbjct: 325 ENIVCNIISQIDGDEQSGKAKKMLAEMVQVSMEQSLRHLQQRALVCTPTPNDLPI 379