BLASTX nr result
ID: Coptis21_contig00007024
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis21_contig00007024 (801 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN71712.1| hypothetical protein VITISV_013459 [Vitis vinifera] 59 1e-06 >emb|CAN71712.1| hypothetical protein VITISV_013459 [Vitis vinifera] Length = 115 Score = 59.3 bits (142), Expect = 1e-06 Identities = 37/108 (34%), Positives = 54/108 (50%), Gaps = 22/108 (20%) Frame = +1 Query: 316 AMKIVGFMEDGVNTTLPYVKKYGGYAVDKIKQ------------------HPYLSGFIVV 441 A ++ F+ + + L ++ +GGY VD++ + P+L +V+ Sbjct: 3 AESVMKFVVEKLKELLVLLENFGGYLVDEVDKVFAPDSRGEKLRHWIQVGAPFLILGLVL 62 Query: 442 FAFVLWKCRCRCTRG----KMMKAPGRDYKMLRGDFEKDPRSYFLDLR 573 F + C C C RG KMMKAPGRDY+M R FE +PR YF LR Sbjct: 63 VVF--YYCCCGCCRGRRGVKMMKAPGRDYRMARPPFESNPRGYFRGLR 108