BLASTX nr result
ID: Coptis21_contig00006985
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis21_contig00006985 (420 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002513513.1| cinnamoyl-CoA reductase, putative [Ricinus c... 68 7e-10 gb|AFY97683.1| cinnamyl alcohol dehydrogenase 1 [Pyrus pyrifolia] 66 3e-09 gb|AAC06319.1| putative cinnamyl alcohol dehydrogenase [Malus x ... 66 3e-09 emb|CAJ43901.1| cinnamyl alcohol dehydrogenase [Quercus ilex] 65 6e-09 gb|ADO51749.1| cinnamyl alcohol dehydrogenase [Camellia sinensis] 65 6e-09 >ref|XP_002513513.1| cinnamoyl-CoA reductase, putative [Ricinus communis] gi|223547421|gb|EEF48916.1| cinnamoyl-CoA reductase, putative [Ricinus communis] Length = 402 Score = 68.2 bits (165), Expect = 7e-10 Identities = 32/38 (84%), Positives = 34/38 (89%) Frame = -2 Query: 116 EIMSSSSGAGKTVCVTGASGYIASWLVKLLLERGYTVK 3 E MSS SG GKTVCVTGASGYIASW+VK LL+RGYTVK Sbjct: 75 EEMSSDSGEGKTVCVTGASGYIASWIVKFLLQRGYTVK 112 >gb|AFY97683.1| cinnamyl alcohol dehydrogenase 1 [Pyrus pyrifolia] Length = 325 Score = 66.2 bits (160), Expect = 3e-09 Identities = 31/33 (93%), Positives = 32/33 (96%) Frame = -2 Query: 101 SSGAGKTVCVTGASGYIASWLVKLLLERGYTVK 3 SSGAGK VCVTGASGYIASWLVKLLL+RGYTVK Sbjct: 2 SSGAGKVVCVTGASGYIASWLVKLLLQRGYTVK 34 >gb|AAC06319.1| putative cinnamyl alcohol dehydrogenase [Malus x domestica] Length = 325 Score = 66.2 bits (160), Expect = 3e-09 Identities = 31/33 (93%), Positives = 32/33 (96%) Frame = -2 Query: 101 SSGAGKTVCVTGASGYIASWLVKLLLERGYTVK 3 SSGAGK VCVTGASGYIASWLVKLLL+RGYTVK Sbjct: 2 SSGAGKVVCVTGASGYIASWLVKLLLQRGYTVK 34 >emb|CAJ43901.1| cinnamyl alcohol dehydrogenase [Quercus ilex] Length = 325 Score = 65.1 bits (157), Expect = 6e-09 Identities = 31/33 (93%), Positives = 31/33 (93%) Frame = -2 Query: 101 SSGAGKTVCVTGASGYIASWLVKLLLERGYTVK 3 SSGAGK VCVTGASGYIASWLVKLLL RGYTVK Sbjct: 2 SSGAGKIVCVTGASGYIASWLVKLLLNRGYTVK 34 >gb|ADO51749.1| cinnamyl alcohol dehydrogenase [Camellia sinensis] Length = 324 Score = 65.1 bits (157), Expect = 6e-09 Identities = 30/32 (93%), Positives = 31/32 (96%) Frame = -2 Query: 98 SGAGKTVCVTGASGYIASWLVKLLLERGYTVK 3 SG GKTVCVTGASGYIASWLVKLLL+RGYTVK Sbjct: 2 SGVGKTVCVTGASGYIASWLVKLLLQRGYTVK 33