BLASTX nr result
ID: Coptis21_contig00006440
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis21_contig00006440 (218 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ACS73574.1| ribulose-1,5-bisphosphate carboxylase/oxygenase l... 62 6e-08 gb|ACS73573.1| ribulose-1,5-bisphosphate carboxylase/oxygenase l... 62 6e-08 gb|ABW34356.1| ribulose-1,5-bisphosphate carboxylase/oxygenase l... 62 6e-08 gb|ABW34349.1| ribulose-1,5-bisphosphate carboxylase/oxygenase l... 62 6e-08 pdb|3RUB|L Chain L, Crystal Structure Of The Unactivated Form Of... 61 1e-07 >gb|ACS73574.1| ribulose-1,5-bisphosphate carboxylase/oxygenase large subunit [Clematis finetiana] Length = 463 Score = 61.6 bits (148), Expect = 6e-08 Identities = 27/34 (79%), Positives = 31/34 (91%) Frame = -3 Query: 168 LAEQGNEIIREACKWSLEVAAACEVWKEIVYDDQ 67 LA +GNEIIREACKWSLE+AAACEVWKEI ++ Q Sbjct: 425 LAREGNEIIREACKWSLELAAACEVWKEIKFEFQ 458 >gb|ACS73573.1| ribulose-1,5-bisphosphate carboxylase/oxygenase large subunit [Clematis armandii] Length = 463 Score = 61.6 bits (148), Expect = 6e-08 Identities = 27/34 (79%), Positives = 31/34 (91%) Frame = -3 Query: 168 LAEQGNEIIREACKWSLEVAAACEVWKEIVYDDQ 67 LA +GNEIIREACKWSLE+AAACEVWKEI ++ Q Sbjct: 425 LAREGNEIIREACKWSLELAAACEVWKEIKFEFQ 458 >gb|ABW34356.1| ribulose-1,5-bisphosphate carboxylase/oxygenase large subunit [Clematis hexapetala] Length = 473 Score = 61.6 bits (148), Expect = 6e-08 Identities = 27/34 (79%), Positives = 31/34 (91%) Frame = -3 Query: 168 LAEQGNEIIREACKWSLEVAAACEVWKEIVYDDQ 67 LA +GNEIIREACKWSLE+AAACEVWKEI ++ Q Sbjct: 435 LAREGNEIIREACKWSLELAAACEVWKEIKFEFQ 468 >gb|ABW34349.1| ribulose-1,5-bisphosphate carboxylase/oxygenase large subunit [Anemone canadensis] Length = 469 Score = 61.6 bits (148), Expect = 6e-08 Identities = 27/34 (79%), Positives = 31/34 (91%) Frame = -3 Query: 168 LAEQGNEIIREACKWSLEVAAACEVWKEIVYDDQ 67 LA +GNEIIREACKWSLE+AAACEVWKEI ++ Q Sbjct: 431 LAREGNEIIREACKWSLELAAACEVWKEIKFEFQ 464 >pdb|3RUB|L Chain L, Crystal Structure Of The Unactivated Form Of Ribulose-1,5-Bisphosphate Carboxylase(Slash)oxygenase From Tobacco Refined At 2.0-Angstroms Resolution Length = 477 Score = 60.8 bits (146), Expect = 1e-07 Identities = 26/32 (81%), Positives = 31/32 (96%) Frame = -3 Query: 168 LAEQGNEIIREACKWSLEVAAACEVWKEIVYD 73 LA++GNEIIREACKWS E+AAACEVWKEIV++ Sbjct: 437 LAQEGNEIIREACKWSPELAAACEVWKEIVFN 468