BLASTX nr result
ID: Coptis21_contig00006358
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis21_contig00006358 (315 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002313041.1| predicted protein [Populus trichocarpa] gi|2... 72 5e-11 ref|XP_002524173.1| conserved hypothetical protein [Ricinus comm... 67 1e-09 ref|NP_565742.1| putative transmembrane protein 97 [Arabidopsis ... 66 3e-09 ref|XP_002889539.1| hypothetical protein ARALYDRAFT_470516 [Arab... 66 3e-09 ref|XP_002881222.1| hypothetical protein ARALYDRAFT_482166 [Arab... 65 8e-09 >ref|XP_002313041.1| predicted protein [Populus trichocarpa] gi|222849449|gb|EEE86996.1| predicted protein [Populus trichocarpa] Length = 145 Score = 72.0 bits (175), Expect = 5e-11 Identities = 36/53 (67%), Positives = 42/53 (79%) Frame = -1 Query: 312 GVSTFTSMVAILSELLGSQKASDKLLMVYGPFLGVAVIAVLRGLVPASKKTSG 154 G S TSMVAIL+ELLGS KASD LLM+Y PFLG+ V+ +LRGL+ S KTSG Sbjct: 93 GSSALTSMVAILAELLGSGKASDDLLMMYSPFLGLGVLCILRGLIQNSSKTSG 145 >ref|XP_002524173.1| conserved hypothetical protein [Ricinus communis] gi|223536542|gb|EEF38188.1| conserved hypothetical protein [Ricinus communis] Length = 161 Score = 67.4 bits (163), Expect = 1e-09 Identities = 31/52 (59%), Positives = 43/52 (82%) Frame = -1 Query: 312 GVSTFTSMVAILSELLGSQKASDKLLMVYGPFLGVAVIAVLRGLVPASKKTS 157 G S FTSMVAI++EL+GS +ASDKL+M++ P LG+ ++A+LRGLVP S T+ Sbjct: 101 GTSIFTSMVAIVAELIGSGRASDKLMMIHAPCLGIGLLAILRGLVPHSGNTA 152 >ref|NP_565742.1| putative transmembrane protein 97 [Arabidopsis thaliana] gi|3831458|gb|AAC69940.1| expressed protein [Arabidopsis thaliana] gi|21618093|gb|AAM67143.1| unknown [Arabidopsis thaliana] gi|28466853|gb|AAO44035.1| At2g32380 [Arabidopsis thaliana] gi|110736581|dbj|BAF00256.1| hypothetical protein [Arabidopsis thaliana] gi|330253581|gb|AEC08675.1| putative transmembrane protein 97 [Arabidopsis thaliana] Length = 168 Score = 65.9 bits (159), Expect = 3e-09 Identities = 31/53 (58%), Positives = 41/53 (77%) Frame = -1 Query: 312 GVSTFTSMVAILSELLGSQKASDKLLMVYGPFLGVAVIAVLRGLVPASKKTSG 154 G S TSM AIL E++GS KAS+KLLM+Y PF+GV ++A+LRGL+ S K+ G Sbjct: 101 GASVVTSMAAILGEMIGSGKASEKLLMMYVPFMGVGILALLRGLLSQSNKSGG 153 >ref|XP_002889539.1| hypothetical protein ARALYDRAFT_470516 [Arabidopsis lyrata subsp. lyrata] gi|297335381|gb|EFH65798.1| hypothetical protein ARALYDRAFT_470516 [Arabidopsis lyrata subsp. lyrata] Length = 168 Score = 65.9 bits (159), Expect = 3e-09 Identities = 32/54 (59%), Positives = 41/54 (75%) Frame = -1 Query: 312 GVSTFTSMVAILSELLGSQKASDKLLMVYGPFLGVAVIAVLRGLVPASKKTSGT 151 G S TSM AIL E++GS KASD+LLM+Y PF+G ++AVLRGLV S K +G+ Sbjct: 101 GASVVTSMAAILGEMIGSGKASDRLLMMYVPFMGFGILAVLRGLVCRSTKNTGS 154 >ref|XP_002881222.1| hypothetical protein ARALYDRAFT_482166 [Arabidopsis lyrata subsp. lyrata] gi|297327061|gb|EFH57481.1| hypothetical protein ARALYDRAFT_482166 [Arabidopsis lyrata subsp. lyrata] Length = 168 Score = 64.7 bits (156), Expect = 8e-09 Identities = 29/53 (54%), Positives = 41/53 (77%) Frame = -1 Query: 312 GVSTFTSMVAILSELLGSQKASDKLLMVYGPFLGVAVIAVLRGLVPASKKTSG 154 G S TSM AIL E++GS KAS+KLL++Y PF+G+ ++A+LRGL+ S K+ G Sbjct: 101 GASVVTSMAAILGEMIGSGKASEKLLIIYVPFMGIGILALLRGLLSQSNKSGG 153