BLASTX nr result
ID: Coptis21_contig00005760
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis21_contig00005760 (222 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003626836.1| Heat shock protein DnaJ N-terminal domain-co... 55 8e-06 >ref|XP_003626836.1| Heat shock protein DnaJ N-terminal domain-containing protein [Medicago truncatula] gi|355520858|gb|AET01312.1| Heat shock protein DnaJ N-terminal domain-containing protein [Medicago truncatula] Length = 487 Score = 54.7 bits (130), Expect = 8e-06 Identities = 27/73 (36%), Positives = 41/73 (56%) Frame = +3 Query: 3 EIEVALLEPLTAADEEKQWVVDKNLPMVCGIFKEMNSKTTVKVTAFSHKVTSKAPRWPLY 182 +++ LEP ++E +WV D+ LP+ CG FK N++T FSH V K + Sbjct: 184 QLQATWLEPHPDDNDEIKWV-DEELPVACGKFKLCNTETIEDHLTFSHPVMFKRNGRDTF 242 Query: 183 DIFPHRGEIWALF 221 ++P +GE WALF Sbjct: 243 QVYPRKGETWALF 255