BLASTX nr result
ID: Coptis21_contig00005562
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis21_contig00005562 (1113 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003637202.1| hypothetical protein MTR_077s0013 [Medicago ... 63 2e-07 ref|XP_003616602.1| hypothetical protein MTR_5g082250 [Medicago ... 58 5e-06 >ref|XP_003637202.1| hypothetical protein MTR_077s0013 [Medicago truncatula] gi|355503137|gb|AES84340.1| hypothetical protein MTR_077s0013 [Medicago truncatula] Length = 586 Score = 62.8 bits (151), Expect = 2e-07 Identities = 31/57 (54%), Positives = 40/57 (70%), Gaps = 2/57 (3%) Frame = -1 Query: 954 MARRGRPRKIGQARMDAAIDALRPMGYDIPLIRRKVNELLEIYQGH--WEIIEQGPY 790 MA R RP K G +RMDAA+DA+ P+G+D LI + VN+LL+IY G+ W IE G Y Sbjct: 1 MAPRRRPLKKGDSRMDAALDAMTPLGFDKKLIHQTVNKLLKIYDGNEGWHFIEDGAY 57 >ref|XP_003616602.1| hypothetical protein MTR_5g082250 [Medicago truncatula] gi|355517937|gb|AES99560.1| hypothetical protein MTR_5g082250 [Medicago truncatula] Length = 225 Score = 57.8 bits (138), Expect = 5e-06 Identities = 26/58 (44%), Positives = 40/58 (68%), Gaps = 2/58 (3%) Frame = -1 Query: 957 PMARRGRPRKIGQARMDAAIDALRPMGYDIPLIRRKVNELLEIYQGH--WEIIEQGPY 790 P R+ R + +G RMDAA+DA+R +G++ +IR V ELL++Y+G+ W IE+G Y Sbjct: 3 PRRRQPRRQTVGNTRMDAALDAMRQLGFEEKIIRDTVEELLDVYEGNQGWPFIEEGSY 60