BLASTX nr result
ID: Coptis21_contig00004912
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis21_contig00004912 (217 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002527439.1| DNA repair helicase rad5,16, putative [Ricin... 64 1e-08 ref|XP_003632276.1| PREDICTED: putative SWI/SNF-related matrix-a... 55 6e-06 emb|CBI17093.3| unnamed protein product [Vitis vinifera] 55 6e-06 ref|XP_002270098.1| PREDICTED: putative SWI/SNF-related matrix-a... 55 6e-06 >ref|XP_002527439.1| DNA repair helicase rad5,16, putative [Ricinus communis] gi|223533174|gb|EEF34931.1| DNA repair helicase rad5,16, putative [Ricinus communis] Length = 1028 Score = 63.9 bits (154), Expect = 1e-08 Identities = 31/45 (68%), Positives = 35/45 (77%) Frame = +1 Query: 1 KLLGMTAFKKAEVTPEDLYTRKRPLGLKEDSGINASLLHICNSKN 135 +LLG+T FKKAE TP DLYTRKRPL K+ SGI A LLH+ SKN Sbjct: 258 RLLGLTPFKKAEFTPADLYTRKRPLNSKDGSGIPALLLHVNKSKN 302 >ref|XP_003632276.1| PREDICTED: putative SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 3-like 2-like [Vitis vinifera] Length = 1029 Score = 55.1 bits (131), Expect = 6e-06 Identities = 25/40 (62%), Positives = 32/40 (80%) Frame = +1 Query: 1 KLLGMTAFKKAEVTPEDLYTRKRPLGLKEDSGINASLLHI 120 +LLG+T FKKAE +P+DLYTRKRPL K++SGI L H+ Sbjct: 260 RLLGLTPFKKAEFSPDDLYTRKRPLESKDNSGIPGLLSHV 299 >emb|CBI17093.3| unnamed protein product [Vitis vinifera] Length = 1025 Score = 55.1 bits (131), Expect = 6e-06 Identities = 25/40 (62%), Positives = 32/40 (80%) Frame = +1 Query: 1 KLLGMTAFKKAEVTPEDLYTRKRPLGLKEDSGINASLLHI 120 +LLG+T FKKAE +P+DLYTRKRPL K++SGI L H+ Sbjct: 256 RLLGLTPFKKAEFSPDDLYTRKRPLESKDNSGIPGLLSHV 295 >ref|XP_002270098.1| PREDICTED: putative SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 3-like 2-like isoform 2 [Vitis vinifera] Length = 1016 Score = 55.1 bits (131), Expect = 6e-06 Identities = 25/40 (62%), Positives = 32/40 (80%) Frame = +1 Query: 1 KLLGMTAFKKAEVTPEDLYTRKRPLGLKEDSGINASLLHI 120 +LLG+T FKKAE +P+DLYTRKRPL K++SGI L H+ Sbjct: 247 RLLGLTPFKKAEFSPDDLYTRKRPLESKDNSGIPGLLSHV 286