BLASTX nr result
ID: Coptis21_contig00004845
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis21_contig00004845 (468 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002513134.1| conserved hypothetical protein [Ricinus comm... 55 8e-06 >ref|XP_002513134.1| conserved hypothetical protein [Ricinus communis] gi|223548145|gb|EEF49637.1| conserved hypothetical protein [Ricinus communis] Length = 66 Score = 54.7 bits (130), Expect = 8e-06 Identities = 27/45 (60%), Positives = 34/45 (75%), Gaps = 1/45 (2%) Frame = -2 Query: 134 GKKRFRSLFWKVRAEMRRRQASMNKRSSFR-RFHYDPFGYSLNFD 3 GK++FRSLFW+VRAE+RR+ M +RS R F YDP Y+LNFD Sbjct: 17 GKRKFRSLFWRVRAEIRRQ---MKRRSKQRFSFQYDPLSYALNFD 58