BLASTX nr result
ID: Coptis21_contig00004492
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis21_contig00004492 (775 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_001147909.1| ANAC076 [Zea mays] gi|195614516|gb|ACG29088.... 56 8e-06 >ref|NP_001147909.1| ANAC076 [Zea mays] gi|195614516|gb|ACG29088.1| ANAC076 [Zea mays] gi|346991194|gb|AEO53059.1| secondary wall NAC transcription factor 7 [Zea mays] gi|413953580|gb|AFW86229.1| putative NAC domain transcription factor superfamily protein [Zea mays] gi|413953588|gb|AFW86237.1| putative NAC domain transcription factor superfamily protein [Zea mays] Length = 349 Score = 56.2 bits (134), Expect = 8e-06 Identities = 39/129 (30%), Positives = 69/129 (53%), Gaps = 19/129 (14%) Frame = +1 Query: 442 SAQTREEMKKLLGLGYSFCPSEGMLVDYYLRKKIMDELIDYCLIEEVDNVYAIHPQDL-- 615 +AQT+++ ++L+ G+ F P++ LVDYYLRKK+ ID +I++VD +Y I P DL Sbjct: 9 AAQTQQQQQQLVPPGFRFHPTDEELVDYYLRKKVASRRIDLNVIKDVD-LYKIEPWDLQD 67 Query: 616 -------AGISQVQYFFTSHPFELQSTDVK-------GRWIAGVKEDIVFKDVK---VGF 744 Q +++F SH + T + G W A ++ ++ + + VG Sbjct: 68 KCRLGGPGEEEQNEWYFFSHKDKKYPTGTRTNRATAAGFWKATGRDKPIYANKQRQLVGM 127 Query: 745 KQTVDYCEG 771 ++T+ Y +G Sbjct: 128 RKTLVYYKG 136