BLASTX nr result
ID: Coptis21_contig00004336
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis21_contig00004336 (471 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004147771.1| PREDICTED: probable carotenoid cleavage diox... 60 2e-07 ref|XP_004161563.1| PREDICTED: probable carotenoid cleavage diox... 59 5e-07 dbj|BAC10552.1| nine-cis-epoxycarotenoid dioxygenase4 [Pisum sat... 57 2e-06 ref|XP_003612461.1| 50S ribosomal protein L14 [Medicago truncatu... 55 5e-06 gb|AEI61930.1| carotenoid cleavage dioxygenase 4 [Nicotiana taba... 55 6e-06 >ref|XP_004147771.1| PREDICTED: probable carotenoid cleavage dioxygenase 4, chloroplastic-like [Cucumis sativus] Length = 591 Score = 59.7 bits (143), Expect = 2e-07 Identities = 23/37 (62%), Positives = 30/37 (81%) Frame = -2 Query: 446 CRMFGNGCYGGEPFFVPKTKDQQNTDELEEDDGYLVT 336 CR+FG GCYGGEPFFVP+ ++ + E EEDDGY+V+ Sbjct: 504 CRIFGPGCYGGEPFFVPRERESSDETEAEEDDGYVVS 540 >ref|XP_004161563.1| PREDICTED: probable carotenoid cleavage dioxygenase 4, chloroplastic-like [Cucumis sativus] Length = 591 Score = 58.5 bits (140), Expect = 5e-07 Identities = 23/37 (62%), Positives = 30/37 (81%) Frame = -2 Query: 446 CRMFGNGCYGGEPFFVPKTKDQQNTDELEEDDGYLVT 336 CR+FG GCYGGEPFFVP+ ++ + E EEDDGY+V+ Sbjct: 504 CRIFGPGCYGGEPFFVPREREISDETEAEEDDGYVVS 540 >dbj|BAC10552.1| nine-cis-epoxycarotenoid dioxygenase4 [Pisum sativum] Length = 574 Score = 56.6 bits (135), Expect = 2e-06 Identities = 26/42 (61%), Positives = 29/42 (69%) Frame = -2 Query: 461 GREAGCRMFGNGCYGGEPFFVPKTKDQQNTDELEEDDGYLVT 336 G E GCRMFG GCYGGEPFFV + +EEDDGYLV+ Sbjct: 486 GEEVGCRMFGEGCYGGEPFFVAR------EGGVEEDDGYLVS 521 >ref|XP_003612461.1| 50S ribosomal protein L14 [Medicago truncatula] gi|355513796|gb|AES95419.1| 50S ribosomal protein L14 [Medicago truncatula] Length = 696 Score = 55.5 bits (132), Expect = 5e-06 Identities = 25/42 (59%), Positives = 29/42 (69%) Frame = -2 Query: 461 GREAGCRMFGNGCYGGEPFFVPKTKDQQNTDELEEDDGYLVT 336 G E GCR++G GCYGGEPFFV + D EEDDGYLV+ Sbjct: 492 GEEVGCRLYGEGCYGGEPFFVAR------EDGEEEDDGYLVS 527 >gb|AEI61930.1| carotenoid cleavage dioxygenase 4 [Nicotiana tabacum] Length = 601 Score = 55.1 bits (131), Expect = 6e-06 Identities = 25/28 (89%), Positives = 27/28 (96%) Frame = -3 Query: 169 IVASVKLPRRVPYGFHGLFVRDTDLTKL 86 IVA+VKLPRRVPYGFHGLFVR+TDL KL Sbjct: 573 IVAAVKLPRRVPYGFHGLFVRETDLRKL 600