BLASTX nr result
ID: Coptis21_contig00004032
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis21_contig00004032 (260 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ACU23521.1| unknown [Glycine max] 58 3e-13 ref|XP_004150398.1| PREDICTED: ubiquitin-conjugating enzyme E2-1... 58 4e-13 dbj|GAA99270.1| hypothetical protein E5Q_05964 [Mixia osmundae I... 59 6e-13 ref|XP_001422486.1| predicted protein [Ostreococcus lucimarinus ... 58 6e-13 ref|XP_002505605.1| predicted protein [Micromonas sp. RCC299] gi... 58 6e-13 >gb|ACU23521.1| unknown [Glycine max] Length = 148 Score = 58.2 bits (139), Expect(3) = 3e-13 Identities = 26/30 (86%), Positives = 27/30 (90%) Frame = +2 Query: 170 LKEQWIPKVTISKVLLSICSLLNDPNPDDP 259 LKEQW P +TISKVLLSICSLL DPNPDDP Sbjct: 89 LKEQWSPALTISKVLLSICSLLTDPNPDDP 118 Score = 33.1 bits (74), Expect(3) = 3e-13 Identities = 13/19 (68%), Positives = 17/19 (89%) Frame = +1 Query: 121 FHPNINSDGSICLGILAKR 177 FHPNINS+G+ICL IL ++ Sbjct: 74 FHPNINSNGNICLDILKEQ 92 Score = 28.1 bits (61), Expect(3) = 3e-13 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +3 Query: 81 HPFKPPKVTFCTK 119 +PFKPPKVTF TK Sbjct: 60 YPFKPPKVTFRTK 72 >ref|XP_004150398.1| PREDICTED: ubiquitin-conjugating enzyme E2-17 kDa-like [Cucumis sativus] gi|449496885|ref|XP_004160253.1| PREDICTED: ubiquitin-conjugating enzyme E2-17 kDa-like [Cucumis sativus] Length = 148 Score = 57.8 bits (138), Expect(3) = 4e-13 Identities = 25/30 (83%), Positives = 27/30 (90%) Frame = +2 Query: 170 LKEQWIPKVTISKVLLSICSLLNDPNPDDP 259 LKEQW P +T+SKVLLSICSLL DPNPDDP Sbjct: 89 LKEQWSPALTVSKVLLSICSLLTDPNPDDP 118 Score = 32.0 bits (71), Expect(3) = 4e-13 Identities = 12/19 (63%), Positives = 17/19 (89%) Frame = +1 Query: 121 FHPNINSDGSICLGILAKR 177 +HPNIN++GSICL IL ++ Sbjct: 74 YHPNINNNGSICLDILKEQ 92 Score = 29.3 bits (64), Expect(3) = 4e-13 Identities = 13/26 (50%), Positives = 16/26 (61%) Frame = +3 Query: 42 GALVQVGVWGDGGHPFKPPKVTFCTK 119 G L V + +PFKPPKV+F TK Sbjct: 47 GGLFSVNIHFPPDYPFKPPKVSFKTK 72 >dbj|GAA99270.1| hypothetical protein E5Q_05964 [Mixia osmundae IAM 14324] Length = 321 Score = 59.3 bits (142), Expect(3) = 6e-13 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = +2 Query: 170 LKEQWIPKVTISKVLLSICSLLNDPNPDDP 259 L+EQW P +TISKVLLSICSLLNDPNPDDP Sbjct: 263 LREQWSPALTISKVLLSICSLLNDPNPDDP 292 Score = 32.0 bits (71), Expect(3) = 6e-13 Identities = 12/19 (63%), Positives = 17/19 (89%) Frame = +1 Query: 121 FHPNINSDGSICLGILAKR 177 +HPNIN++GSICL IL ++ Sbjct: 248 YHPNINANGSICLDILREQ 266 Score = 26.9 bits (58), Expect(3) = 6e-13 Identities = 10/13 (76%), Positives = 11/13 (84%) Frame = +3 Query: 81 HPFKPPKVTFCTK 119 +PFKPPKV F TK Sbjct: 234 YPFKPPKVAFTTK 246 >ref|XP_001422486.1| predicted protein [Ostreococcus lucimarinus CCE9901] gi|144582729|gb|ABP00803.1| predicted protein [Ostreococcus lucimarinus CCE9901] Length = 149 Score = 58.2 bits (139), Expect(3) = 6e-13 Identities = 26/30 (86%), Positives = 27/30 (90%) Frame = +2 Query: 170 LKEQWIPKVTISKVLLSICSLLNDPNPDDP 259 LKEQW P +TISKVLLSICSLL DPNPDDP Sbjct: 90 LKEQWSPALTISKVLLSICSLLTDPNPDDP 119 Score = 32.3 bits (72), Expect(3) = 6e-13 Identities = 12/19 (63%), Positives = 16/19 (84%) Frame = +1 Query: 121 FHPNINSDGSICLGILAKR 177 +HPN+NS GSICL IL ++ Sbjct: 75 YHPNVNSQGSICLDILKEQ 93 Score = 27.7 bits (60), Expect(3) = 6e-13 Identities = 13/26 (50%), Positives = 15/26 (57%) Frame = +3 Query: 42 GALVQVGVWGDGGHPFKPPKVTFCTK 119 G L V + +PFKPPKV F TK Sbjct: 48 GGLFFVAIHFPPDYPFKPPKVNFKTK 73 >ref|XP_002505605.1| predicted protein [Micromonas sp. RCC299] gi|226520875|gb|ACO66863.1| predicted protein [Micromonas sp. RCC299] Length = 148 Score = 58.2 bits (139), Expect(3) = 6e-13 Identities = 26/30 (86%), Positives = 27/30 (90%) Frame = +2 Query: 170 LKEQWIPKVTISKVLLSICSLLNDPNPDDP 259 LKEQW P +TISKVLLSICSLL DPNPDDP Sbjct: 90 LKEQWSPALTISKVLLSICSLLTDPNPDDP 119 Score = 32.3 bits (72), Expect(3) = 6e-13 Identities = 12/19 (63%), Positives = 16/19 (84%) Frame = +1 Query: 121 FHPNINSDGSICLGILAKR 177 +HPN+NS GSICL IL ++ Sbjct: 75 YHPNVNSQGSICLDILKEQ 93 Score = 27.7 bits (60), Expect(3) = 6e-13 Identities = 13/26 (50%), Positives = 15/26 (57%) Frame = +3 Query: 42 GALVQVGVWGDGGHPFKPPKVTFCTK 119 G L V + +PFKPPKV F TK Sbjct: 48 GGLFFVAIHFPPDYPFKPPKVNFKTK 73