BLASTX nr result
ID: Coptis21_contig00003545
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis21_contig00003545 (257 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004166461.1| PREDICTED: LOW QUALITY PROTEIN: actin-101-li... 74 1e-11 ref|XP_004147353.1| PREDICTED: actin-7-like [Cucumis sativus] gi... 74 1e-11 gb|ADV04491.1| beta-actin [Camellia sinensis] 74 1e-11 gb|AAW63030.1| actin [Isatis tinctoria] 74 1e-11 gb|AAP73459.1| actin [Gossypium hirsutum] 74 1e-11 >ref|XP_004166461.1| PREDICTED: LOW QUALITY PROTEIN: actin-101-like [Cucumis sativus] Length = 107 Score = 74.3 bits (181), Expect = 1e-11 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -3 Query: 255 GGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 154 GGSILASLSTFQQMWISKGEYDESGPSIVHRKCF Sbjct: 74 GGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 107 >ref|XP_004147353.1| PREDICTED: actin-7-like [Cucumis sativus] gi|449461823|ref|XP_004148641.1| PREDICTED: actin-7-like [Cucumis sativus] gi|449532903|ref|XP_004173417.1| PREDICTED: actin-7-like [Cucumis sativus] Length = 377 Score = 74.3 bits (181), Expect = 1e-11 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -3 Query: 255 GGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 154 GGSILASLSTFQQMWISKGEYDESGPSIVHRKCF Sbjct: 344 GGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 377 >gb|ADV04491.1| beta-actin [Camellia sinensis] Length = 377 Score = 74.3 bits (181), Expect = 1e-11 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -3 Query: 255 GGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 154 GGSILASLSTFQQMWISKGEYDESGPSIVHRKCF Sbjct: 344 GGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 377 >gb|AAW63030.1| actin [Isatis tinctoria] Length = 377 Score = 74.3 bits (181), Expect = 1e-11 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -3 Query: 255 GGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 154 GGSILASLSTFQQMWISKGEYDESGPSIVHRKCF Sbjct: 344 GGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 377 >gb|AAP73459.1| actin [Gossypium hirsutum] Length = 377 Score = 74.3 bits (181), Expect = 1e-11 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -3 Query: 255 GGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 154 GGSILASLSTFQQMWISKGEYDESGPSIVHRKCF Sbjct: 344 GGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 377