BLASTX nr result
ID: Coptis21_contig00002651
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis21_contig00002651 (325 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002530965.1| conserved hypothetical protein [Ricinus comm... 72 6e-11 ref|XP_002325891.1| predicted protein [Populus trichocarpa] gi|2... 69 5e-10 ref|XP_002319207.1| predicted protein [Populus trichocarpa] gi|2... 67 2e-09 emb|CBI31178.3| unnamed protein product [Vitis vinifera] 62 5e-08 ref|XP_003554073.1| PREDICTED: uncharacterized protein LOC100778... 58 7e-07 >ref|XP_002530965.1| conserved hypothetical protein [Ricinus communis] gi|223529480|gb|EEF31437.1| conserved hypothetical protein [Ricinus communis] Length = 1204 Score = 71.6 bits (174), Expect = 6e-11 Identities = 30/56 (53%), Positives = 42/56 (75%) Frame = +1 Query: 157 MGMDAMEIRVQIQKVLIFTMKTSYRSACDHPFILGMLCFFIFLYTYLPSLFFFLVS 324 MG+DAM IRV+I++ L+ +++T Y+S C HPF++G +CF IFLY P LF LVS Sbjct: 1 MGLDAMRIRVEIKRFLVISIRTCYKSVCKHPFLVGFVCFLIFLYKSFPFLFSLLVS 56 >ref|XP_002325891.1| predicted protein [Populus trichocarpa] gi|222862766|gb|EEF00273.1| predicted protein [Populus trichocarpa] Length = 1384 Score = 68.6 bits (166), Expect = 5e-10 Identities = 29/57 (50%), Positives = 41/57 (71%) Frame = +1 Query: 154 KMGMDAMEIRVQIQKVLIFTMKTSYRSACDHPFILGMLCFFIFLYTYLPSLFFFLVS 324 +MG+DAM+IRVQI+K + + YRS C HPF++GM+C+ + LY+ P LF LVS Sbjct: 15 RMGIDAMKIRVQIRKFSVILFRLCYRSVCKHPFLVGMVCYLLLLYSSFPVLFSLLVS 71 >ref|XP_002319207.1| predicted protein [Populus trichocarpa] gi|222857583|gb|EEE95130.1| predicted protein [Populus trichocarpa] Length = 1661 Score = 67.0 bits (162), Expect = 2e-09 Identities = 28/56 (50%), Positives = 40/56 (71%) Frame = +1 Query: 157 MGMDAMEIRVQIQKVLIFTMKTSYRSACDHPFILGMLCFFIFLYTYLPSLFFFLVS 324 MG+DAM IRVQI++ L+ + + YRS C HPF++GM+C+ + LY P LF LV+ Sbjct: 1 MGIDAMRIRVQIRRFLVISFQLCYRSVCKHPFLVGMVCYLLLLYRSFPFLFSLLVT 56 >emb|CBI31178.3| unnamed protein product [Vitis vinifera] Length = 1205 Score = 62.0 bits (149), Expect = 5e-08 Identities = 27/56 (48%), Positives = 39/56 (69%) Frame = +1 Query: 157 MGMDAMEIRVQIQKVLIFTMKTSYRSACDHPFILGMLCFFIFLYTYLPSLFFFLVS 324 MG D ++I +QI++ LIF+ + YRS C+HPF++G + F IFLY P +F LVS Sbjct: 1 MGFDGLKIGIQIKRGLIFSTRICYRSVCNHPFLVGFVFFLIFLYRSFPFVFSILVS 56 >ref|XP_003554073.1| PREDICTED: uncharacterized protein LOC100778840 [Glycine max] Length = 1348 Score = 58.2 bits (139), Expect = 7e-07 Identities = 23/50 (46%), Positives = 36/50 (72%) Frame = +1 Query: 175 EIRVQIQKVLIFTMKTSYRSACDHPFILGMLCFFIFLYTYLPSLFFFLVS 324 EI ++++KV++ +++ YRSAC+HPF++G CF + LY P LF LVS Sbjct: 4 EIGIKVRKVVVISIRGGYRSACNHPFLVGFFCFLLLLYRSFPFLFSVLVS 53