BLASTX nr result
ID: Coptis21_contig00002418
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis21_contig00002418 (852 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAQ84111.1| Clt1 [Citrus trifoliata] 99 1e-18 gb|AFK38849.1| unknown [Lotus japonicus] gi|388522485|gb|AFK4930... 99 2e-18 gb|ACV50425.1| cold induced plasma membrane protein [Jatropha cu... 97 6e-18 gb|AAF26091.1|AC012393_17 low temperature and salt responsive pr... 95 2e-17 gb|ADK27676.1| plasma membrane protein 3-1 [Salvia miltiorrhiza] 95 2e-17 >gb|AAQ84111.1| Clt1 [Citrus trifoliata] Length = 54 Score = 99.0 bits (245), Expect = 1e-18 Identities = 46/54 (85%), Positives = 50/54 (92%) Frame = +1 Query: 364 MSGATVVEIILSIILPPLGVFLRFGCKAEFWICLLLTILGYIPGIIYAVYTITK 525 M AT V+IIL++ILPPLGVFL+FGCKAEFWICLLLTILGYIPGIIYAVY ITK Sbjct: 1 MGTATCVDIILAVILPPLGVFLKFGCKAEFWICLLLTILGYIPGIIYAVYVITK 54 >gb|AFK38849.1| unknown [Lotus japonicus] gi|388522485|gb|AFK49304.1| unknown [Lotus japonicus] Length = 54 Score = 98.6 bits (244), Expect = 2e-18 Identities = 46/54 (85%), Positives = 49/54 (90%) Frame = +1 Query: 364 MSGATVVEIILSIILPPLGVFLRFGCKAEFWICLLLTILGYIPGIIYAVYTITK 525 M AT V+IIL+IILPPLGVFLRFGCK EFWICLLLTILGYIPGIIYA+Y ITK Sbjct: 1 MGTATCVDIILAIILPPLGVFLRFGCKVEFWICLLLTILGYIPGIIYAIYAITK 54 >gb|ACV50425.1| cold induced plasma membrane protein [Jatropha curcas] Length = 57 Score = 96.7 bits (239), Expect = 6e-18 Identities = 43/51 (84%), Positives = 49/51 (96%) Frame = +1 Query: 373 ATVVEIILSIILPPLGVFLRFGCKAEFWICLLLTILGYIPGIIYAVYTITK 525 AT ++I+L++ILPPLGVFL+FGCKAEFWICLLLTILGYIPGIIYAVY ITK Sbjct: 7 ATCIDILLAVILPPLGVFLKFGCKAEFWICLLLTILGYIPGIIYAVYAITK 57 >gb|AAF26091.1|AC012393_17 low temperature and salt responsive protein LTI6B [Arabidopsis thaliana] Length = 67 Score = 95.1 bits (235), Expect = 2e-17 Identities = 43/56 (76%), Positives = 50/56 (89%) Frame = +1 Query: 364 MSGATVVEIILSIILPPLGVFLRFGCKAEFWICLLLTILGYIPGIIYAVYTITK*N 531 MS AT VEIIL+IILPPLGVFL+FGCK EFWICL+LT+ GY+PGI+YA+Y ITK N Sbjct: 1 MSTATFVEIILAIILPPLGVFLKFGCKVEFWICLILTLFGYLPGILYALYIITKKN 56 >gb|ADK27676.1| plasma membrane protein 3-1 [Salvia miltiorrhiza] Length = 55 Score = 95.1 bits (235), Expect = 2e-17 Identities = 42/54 (77%), Positives = 50/54 (92%) Frame = +1 Query: 364 MSGATVVEIILSIILPPLGVFLRFGCKAEFWICLLLTILGYIPGIIYAVYTITK 525 M+ AT ++II++IILPPLGVFL+FGCK EFW+CLLLT+LGYIPGIIYAVY ITK Sbjct: 1 MAAATCIDIIVAIILPPLGVFLKFGCKHEFWLCLLLTLLGYIPGIIYAVYAITK 54