BLASTX nr result
ID: Coptis21_contig00002405
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis21_contig00002405 (229 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABD28627.2| RNA-directed DNA polymerase (Reverse transcriptas... 55 6e-06 >gb|ABD28627.2| RNA-directed DNA polymerase (Reverse transcriptase); Ribonuclease H [Medicago truncatula] Length = 1296 Score = 55.1 bits (131), Expect = 6e-06 Identities = 26/67 (38%), Positives = 37/67 (55%) Frame = -1 Query: 220 FWKSINDCNSLKCNSRGIHLTWSNNLDGLRRIYSKLERGIINYEWRLKYRGWKYKA*CRA 41 F +N+CN L + G TW N +G+R + KL+RG+ N +WRL + + CR Sbjct: 160 FSNFMNNCNLLDLTTTGGRFTWHKNNNGIRILSKKLDRGMANVDWRLSFPEAFVEVLCRL 219 Query: 40 GSDHAPL 20 SDH PL Sbjct: 220 HSDHNPL 226